CANTATAdb - search

Detailed information on CNT30612154

BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)

Target	Query species	Target species	Query coverage (%)	Target coverage (%)	Identity	Alignment length (nt)	Orientation
CNT30698009	Arabis alpina	Quercus lobata	25	24.44	89.47	76	forward
CNT30616204	Arabis alpina	Sesamum indicum	24.01	17.51	89.04	73	reverse complement
CNT30272829	Arabis alpina	Chenopodium quinoa	24.34	24.1	89.19	74	reverse complement
CNT30381728	Arabis alpina	Manihot esculenta	20.72	20.45	90.48	63	reverse complement
CNT30526769	Arabis alpina	Phaseolus vulgaris	24.01	24.83	89.04	73	reverse complement
CNT30506771	Arabis alpina	Nicotiana attenuata	22.37	22.3	88.24	68	reverse complement
CNT3043300	Arabis alpina	Prunus dulcis	48.03	47.56	84.93	146	reverse complement
CNT30158859	Arabis alpina	Pistacia vera	24.34	25.78	89.19	74	forward
CNT3094411	Arabis alpina	Solanum tuberosum	23.03	23.49	87.14	70	forward
CNT30561830	Arabis alpina	Actinidia chinensis	22.04	21.97	92.54	67	forward
CNT30587521	Arabis alpina	Musa acuminata	23.03	21.41	91.43	70	reverse complement
CNT3084328	Arabis alpina	Vigna radiata	25.33	25.33	89.61	77	reverse complement
CNT30509042	Arabis alpina	Solanum lycopersicum	25	24.84	85.53	76	reverse complement
CNT30143579	Arabis alpina	Medicago truncatula	25.33	25.41	85.71	77	reverse complement
CNT30232760	Arabis alpina	Ananas comosus	23.03	15.35	87.14	70	reverse complement
CNT30652801	Arabis alpina	Rosa chinensis	25.33	25.16	89.61	77	reverse complement
CNT30361740	Arabis alpina	Sorghum bicolor	21.71	21.64	87.88	66	reverse complement
CNT30410045	Arabis alpina	Papaver somniferum	22.37	22.97	91.18	68	forward
CNT3029804	Arabis alpina	Theobroma cacao	20.72	20.52	88.89	63	reverse complement
CNT3058191	Arabis alpina	Amborella trichopoda	25	24.76	90.79	76	reverse complement
CNT30121042	Arabis alpina	Citrus clementina	24.34	24.58	89.19	74	forward
CNT3050536	Arabis alpina	Cucumis sativus	22.37	22.3	91.18	68	reverse complement

Expression of CNT30612154

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MGEPNNSPTRTQPNEINPTFHHFIVSTWITSQRY*

Sequence

>CNT30612154
AAAAGTGATGGTCCAATAGGAATTGGTTTATCAGGTCATTGAGGGCTCGGAAGACCATGGCTCGTTATCCTTCCACCGTCAAGAGCGGGAGGTGGACGCT
GCTCTGTGAAACCAGCCTCACGCAGTCTCCTCCACTCTAGAAGACAAGTGACCCGAACCTTCGCTCAAGCCCCTTGTCTCAACTCCCAACTTGGAATGGG
CGAGCCAAATAACAGCCCAACCCGAACCCAGCCCAATGAGATCAACCCAACTTTTCATCACTTTATTGTCTCCACTTGGATCACAAGCCAACGTTACTAG
GCTC