Detailed information on CNT30611006


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30317874Arabis alpinaCorylus avellana35.243.8582.24107forward
CNT30373064Arabis alpinaArabidopsis thaliana90.1347.9995.62274forward
CNT30708847Arabis alpinaGlycine max34.2110.8284.62104forward
CNT30398713Arabis alpinaTriticum turgidum37.541.9185.09114forward
CNT30567579Arabis alpinaActinidia chinensis31.2527.783.1695forward
CNT3085325Arabis alpinaVigna radiata33.2214.2983.17101forward
CNT30542306Arabis alpinaBrassica napus26.6417.6191.3681forward
CNT30238041Arabis alpinaBrassica oleracea70.0728.0392.96213forward
CNT30511681Arabis alpinaSolanum lycopersicum36.5133.4384.68111forward
CNT30668910Arabis alpinaTriticum dicoccoides37.540.5785.09114forward
CNT30313764Arabis alpinaCamelina sativa29.2812.9792.1389forward
CNT3080335Arabis alpinaBrassica juncea33.2217.8189.11101forward
CNT308572Arabis alpinaZea mays37.539.3184.21114forward
CNT30714890Arabis alpinaMalus domestica golden40.1343.4283.61122forward
CNT30624929Arabis alpinaDaucus carota49.0143.0681.21149forward
CNT30368346Arabis alpinaSorghum bicolor37.542.2284.21114forward
CNT30359648Arabis alpinaLactuca sativa35.5327.6985.19108forward
CNT30704829Arabis alpinaPrunus avium23.3611.4385.9271forward
CNT30119031Arabis alpinaCitrus clementina40.1316.0783.61122forward

Expression of CNT30611006

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MSDLKETLSTDSSSMNHSLRDPLSGEISNLFDQMVVLKKNR

>peptide 2 (48 aa)
MRHVVQYPPVLLDVSFRVRFQRVNNGGETDNNRSLNTRGSEKISTSEV*

Sequence

>CNT30611006
CACCATGTCAACAAACTCTCTGGTAAATGAGACATGTAGTCCAATATCCTCCAGTACTCTTGGATGTTAGTTTTCGGGTTCGGTTTCAGCGCGTGAACAA
CGGTGGAGAAACGGACAATAACCGGAGTTTGAACACCAGGGGCTCTGAGAAAATCAGCACAAGTGAGGTTTGAAATGTCATGAGTGACCTCAAAGAAACC
CTTAGCACTGATTCCTCTAGCATGAACCACTCTCTCAGGGATCCTCTCTCTGGTGAAATTAGCAACCTTTTCGATCAGATGGTAGTCCTCAAGAAGAACC
GGAC