Detailed information on CNT30604902


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30712490Oryza punctataGlycine max20.6211.8891.0467forward
CNT30555545Oryza punctataOryza glaberrima39.0815.3692.91127forward
CNT30648337Oryza punctataRosa chinensis27.6919.5787.7890forward
CNT30597252Oryza punctataOryza meridionalis39.0827.9190.55127forward
CNT30371468Oryza punctataOryza glumipatula39.0811.0392.13127forward
CNT30104366Oryza punctataOryza rufipogon39.0817.6692.91127forward
CNT30578609Oryza punctataOryza barthii83.0810.3192.22270forward
CNT30117982Oryza punctataOryza nivara39.0814.1994.49127forward

Expression of CNT30604902

Peptides detected in this lncRNA

>peptide 1 (63 aa)
MTQNKAAYYYYRQQSTSVMLDLSLVATGLLATRGLVGDEANALHLPDVVEADDTDKGIGVGLLG

Sequence

>CNT30604902
GGGGAGGGAGAGGGAGAGATTATTACATATGCGTTAAAGAGCATAGAACGCATAGACCATAGAGATGGTATATAACCAAACTGGAAAAAGAAACAAAATA
TATAGCGTATTATAATTTATATATCCTCAACATGACCCAAAACAAAGCTGCATACTATTATTATAGGCAGCAATCCACCAGCGTGATGCTTGATCTTAGC
TTAGTTGCCACCGGACTCCTCGCAACCCGGGGGCTTGTAGGCGATGAAGCTAATGCACTGCACCTGCCTGACGTTGTCGAAGCCGATGATACGGACAAAG
GCATCGGGGTAGGCCTTCTTGGCCT