Detailed information on CNT30604899


BLAST search results

BLAST vs Swiss-Prot:
sp|Q2QLY5|METE1_ORYSJ, E-value = 8e-38

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672513Oryza punctataSetaria viridis24.4614.2592.9857forward
CNT30224666Oryza punctataHordeum vulgare42.9245.0589100forward
CNT30555664Oryza punctataOryza glaberrima88.4193.2198.54206forward
CNT30264857Oryza punctataBrassica rapa26.6120.687.162forward
CNT30212158Oryza punctataHelianthus annuus24.4614.6587.7257forward
CNT30129112Oryza punctataCorymbia citriodora36.9123.1283.7286forward
CNT30367300Oryza punctataSorghum bicolor48.0724.8385.71112forward
CNT30619828Oryza punctataCajanus cajan30.919.8984.7272forward
CNT30597166Oryza punctataOryza meridionalis80.2666.3197.86187forward
CNT30358925Oryza punctataLactuca sativa33.4820.4284.6278forward
CNT30105511Oryza punctataOryza longistaminata95.2888.896.85222forward
CNT3027096Oryza punctataPopulus trichocarpa40.7727.384.2195forward
CNT30104583Oryza punctataOryza rufipogon88.4197.1798.06206forward
CNT30578457Oryza punctataOryza barthii95.7139.3398.21223forward
CNT30118059Oryza punctataOryza nivara76.3960.7597.75178forward
CNT30333329Oryza punctataCynara cardunculus47.2122.7385.45110forward

Expression of CNT30604899

Peptides detected in this lncRNA

>peptide 1 (56 aa)
FPTIASRDSRVVRDAARSSAQMLRPSTTPAKRYLPEGKPALLTRSRVLAPRIRSKP*

>peptide 2 (76 aa)
LSNNSLKRLKGGERCSEIISPDVASIHNTSKEVLARGETSTLDKVKSLGSTDKVKTISSHAVQGCEGPAVKRQYSVS

Sequence

>CNT30604899
CCTTTCCAACAATAGCCTCAAGAGACTCAAGGGTGGTGAGAGATGCAGCGAGATCATCAGCCCAGATGTTGCGTCCATCCACAACACCAGCAAAGAGGTA
CTTGCCAGAGGGGAAACCAGCACTCTTGACAAGGTCAAGAGTCTTGGCTCCACGGATAAGGTCAAAACCATAAGCAGTCACGCTGTTCAGGGATGTGAGG
GTCCTGCAGTGAAAAGGCAGTATTCAGTGTCCT