Detailed information on CNT30604850


BLAST search results

BLAST vs Swiss-Prot:
sp|P23993|PSAL_HORVU, E-value = 9e-25

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672862Oryza punctataSetaria viridis22.8651.2787.84222forward
CNT30520920Oryza punctataSetaria italica15.7622.0895.42153forward
CNT30292897Oryza punctataTriticum aestivum13.1821.7388.28128forward
CNT30222283Oryza punctataHordeum vulgare9.8922.8689.5896forward
CNT30564216Oryza punctataActinidia chinensis5.8725.5689.4757forward
CNT30438727Oryza punctataAegilops tauschii13.0840.1991.34127forward
CNT30662078Oryza punctataTriticum dicoccoides9.6832.4186.1794forward
CNT30454500Oryza punctataSaccharum spontaneum11.6431.2288.5113forward
CNT30135064Oryza punctataLolium perenne16.0727.3288.46156forward
CNT3014019Oryza punctataZea mays15.6521.6294.08152forward
CNT30610860Oryza punctataGossypium raimondii6.082088.1459forward
CNT30720963Oryza punctataTriticum spelta13.1822.9888.28128forward
CNT30344813Oryza punctataEragrostis tef15.7629.2594.77153forward
CNT30578384Oryza punctataOryza barthii8.3420.6610081forward
CNT30582394Oryza punctataEchinochloa crusgalli8.8623.0696.5186forward
CNT30557050Oryza punctataPanicum hallii8.4421.5896.3482forward
CNT30551896Oryza punctataOryza brachyantha15.9623.3896.13155forward

Expression of CNT30604850

Peptides detected in this lncRNA

>peptide 1 (75 aa)
AGELGPAVGGLQLVGLLLAAGERQRRRRGRLALAEGCDAVHGEADAEDGDERAGGHRRLQAADEGVAVDGLHHLG*

>peptide 2 (34 aa)
MCSNSDWGMLLYTFTGVVTNVQEWIYQCKKRKKN*

>peptide 3 (54 aa)
MFRSGSTNVKKEKKTNVPNCSEYLKNKKKALLSILYQDSTPIRAQSHLNNMHLLN

>peptide 4 (65 aa)
MSNYLSFLSIESYVSNSFSRPRMTEEISLQETVRTAFSNYLILAVTMVKLTLINFNSITEKASPN*

>peptide 5 (82 aa)
PPVNLAQPSAVCSLSASFLRPVSVSVGAVDGSPSPKDATPYMVRQTLRMATSGLEVTGVSRLPMKGSPLMGCTTWGKIAKEK*

Sequence

>CNT30604850
CCGCCGGTGAACTTGGCCCAGCCGTCGGCGGTCTGCAGCTTGTCGGCCTCCTTCTTGCGGCCGGTGAGCGTCAGCGTCGGCGCCGTGGACGGCTCGCCCT
CGCCGAAGGATGCGACGCCGTACATGGTGAGGCAGACGCTGAGGATGGCGACGAGCGGGCTGGAGGTCACCGGCGTCTCCAGGCTGCCGATGAAGGGGTC
GCCGTTGATGGGTTGCACCACCTGGGGTAAAATTGCAAAGGAAAAATGAACACAAATGAAGGACCATGAAAAAGGTTGCGATGTCCAAAATAATGCATGT
CCAACTATCTGTCCTTCCTGAGTATAGAAAGTTATGTTAGCAATTCATTCTCCAGACCACGTATGACTGAAGAAATTTCCTTACAAGAAACAGTCCGGAC
TGCATTCTCAAACTACCTAATACTAGCAGTTACAATGGTGAAATTGACACTGATCAACTTCAATTCAATAACTGAAAAGGCATCCCCTAATTAAGCATCA
ACCAGTATAAATTGCAACTGAGAAATTCTAAATCAACTTCCTTTTGTTGTTATAATTATCCAAGACAATCTTCAATCATCAAATTAGCTCCAATTTTCCA
GAAACGCCTCTAAATCCTATGATCCCTATGATGTGACAAGGAAAGCTTAGGACCCCACACCCTCTGGAATAAGAACTTAGTCTACAAATTTTTTGACACA
TAATTAGTGAATCAAGCATTAGGTTGTGAGGTTTAAAATCAACACTCGATGTGTTCCAACTCTGATTGGGGAATGTTATTGTATACCTTTACAGGTGTGG
TTACCAATGTTCAGGAGTGGATCTACCAATGTAAAAAAAGAAAAAAAAACTAACGTACCTAATTGTTCTGAGTATTTAAAGAACAAAAAAAAAGCCCTTC
TCAGCATATTGTATCAGGATTCCACACCCATCAGAGCACAATCACACCTAAACAACATGCATCTATTAAAC