Detailed information on CNT30604752


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697735Oryza punctataOryza sativa16.3227.2686.83562forward
CNT30597209Oryza punctataOryza meridionalis28.9356.9185.84996forward
CNT30110006Oryza punctataOryza longistaminata12.4322.0890.89428forward
CNT30104708Oryza punctataOryza rufipogon11.5322.6287.15397forward
CNT30578480Oryza punctataOryza barthii16.2931.5286.99561forward

Expression of CNT30604752

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MSWSWLRLVRCIRLSTHSIQDWCCVFLIKTN*

>peptide 2 (38 aa)
MSNACLLVLLAFHSSTNVSILLYVLKINLAQFLCRFIP*

>peptide 3 (36 aa)
MGECPFPCIMLCSSLRMCHGFIYFMVNIYVCQMHAY*

>peptide 4 (41 aa)
MANCGLLCWKYYVKIARSVGLRQFMFGAMDLSYGYFGLDQG*

>peptide 5 (39 aa)
MKQRLKVLSRNHLLYELWSSSQLGVLVYFSSSAFGLYCS*

>peptide 6 (45 aa)
TDSNRLGFRLGALLYKCKPVPPASHRRGCRCLPSSSFRRGWMVSR*

>peptide 7 (42 aa)
PIPTDSVSASVLSSINASPFPLPLIAVDVDVFLPPLSAAGGW*

>peptide 8 (61 aa)
MYLHAWNFHFIIVWTLHVLVQLLTDFLSSNFVLGFNLLRHFSSLDKLGQSLTGCFSFVYEL*

>peptide 9 (32 aa)
MLVQGLQITCLWVLGLSWFASITATMRTLSVK*

>peptide 10 (29 aa)
MILLCHLVKVTSGFLSRRFKELFFDCLPC*

>peptide 11 (46 aa)
MQARSPCLSSPWMSMSSFLLFPPRVDGKSVGKGSIGFDLTSFVAVC*

>peptide 12 (34 aa)
MLGSLRPFVCLPLCSFSFRSGNFCDNKVKSCQKI*

>peptide 13 (31 aa)
MLRLRGRLVCVNSCSVRWICHMDILGLIKAR*

Sequence

>CNT30604752
ACCGATTCCAACCGACTCGGTTTCCGCCTCGGTGCTCTCCTCTATAAATGCAAGCCCGTTCCCCCTGCCTCTCATCGCCGTGGATGTCGATGTCTTCCTT
CCTCCTCTTTCCGCCGCGGGTGGATGGTAAGTCGGTAGGTAAGGGATCCATCGGTTTCGATCTCACCTCGTTCGTTGCCGTTTGTTGATTGATCAGGTTC
ACCAACTAGCCGGGTAGATCGCCCGCTTGCTCGTCTTTTTCTCTGGTGCTTGATCCGTTCGGTTTGGGGTTCTAGTTTCGGCGATTCGTCCCCCTTTGTT
GTGTTAGTTTTCTGGGCAGCCTCTCTTTCGATTGGTTTATGGCTAATTGTGGTTTGCTGTGTTGGAAATACTATGTTAAGATTGCGCGGTCGGTTGGTTT
GCGTCAATTCATGTTCGGTGCGATGGATTTGTCATATGGATATTTTGGGCTTGATCAAGGCTAGATAAACTGAAGTTTTCGCTCTGAAATGGTCATGGTT
ACTAGGATTGCTCACTGGCCTAAGATTATTGTTCTGTTCCTTTCAAGTCTGTGATGCTTGGTAGTTTGAGACCATTCGTCTGCTTGCCATTATGCAGTTT
TTCCTTCAGATCTGGTAATTTTTGTGATAATAAGGTCAAGTCCTGTCAGAAAATTTAAGCATGATTTGGGAGGTTTTTATTAGGTCTGTTCAGAGCTTTC
AAATCACCGGCTTTATACTCTTCAGATTATCTTGAAGATGGTTGGGTCTTATCTTAAGAGGATCATGTAATGCTTTTTGGCTTTGATAAAAGTCGGCGCT
ATGTGCTCAAGTTTGGGGTGAACTAGGGCGTTGGAATGATTCTTCTGTGTCACTTAGTTAAAGTTACTTCAGGATTTCTTTCACGAAGATTTAAGGAGCT
CTTTTTTGACTGCCTTCCATGTTGATTGATTTATCCTAGTACAGGAACTACAGATTACTTGCTACTTGACCTGCTCAGTTTGAGTTGATTTGCTTCCATT
ACAAGTGATTGTCCAAGAACATTTTATCTGTAATACGAGCACTTAAACCAGAGAAAGCGAAGCTTGTGGTATGGATTGGTCATGGTTAGGAATAGTCATT
TAAGCGTTATTGGTTTATTAGGTCTGTTCAGAGCTTTCAAATCACTGACTACTACTCGGATTATTTGAAGATGGTTGGGGCCAAGTGCTACTTTTTTTTC
AAAATTGGTACTATGTGCTCAAGTTTGAGGTAAACGAGGGTGTTGGAACGATTCTTCAGCAGTGTTCTTCTGTATCAGTTCTTAGTGAAAAGTTTAACTT
CAGGATTTCTTTCACAAGGATTTAAGGAGTTCTTTTTTCCTGCCTTCCCTATGGATTAATTTTATGCTAGTACAGGGACTACAGATTACTTGTCTTTGGG
TGCTTGGTTTGAGTTGGTTTGCTTCCATTACAGCGACTATGCGAACTTTATCTGTAAAATGAACATTTATGGCATACTGAAACCAGAGAAATTGGAGCCT
GTGGTATGAGTTGGTCATGGTTAAGACTAGTTAGGTGTATAAGATTGTCTACCCATTCCATTCAAGATTGGTGCTGCGTTTTTCTGATCAAAACTAACTA
GTGATTGAAGTTATTTGGATGCGATTTGTCCTGATCAAAACTAACAAGTGATTGATATTATTTGGAGGCAATTTGTATTGCTTGGAGAACTCAGGTTATT
AAGTCCCATCCTGCTACCCTTTTATGGTTAAGTCAGTCTTTAGACATGATCATAGTTCTCAGAGAATTCGGTGTTGACTTGTCAGTTATTATGGAGGTTA
TATAGTAGCTAAAAGACACATCCTAAAGTTTCAGTGGTAGATGATTCATTTCATTTGGCAGTTACTTCCTTTGAACAACATACAAGGTTGTGAAGGTGAT
TCTGGGATCTTTTGACTATACTTGGTGAAATTAAATTGAAGATTTGTTTCAAGAAAATATATGGGCCTGAATTTGCTTTCCTGCTGTGAGAAGTAAGTTC
GATGGTTGAGTACAAAATGTGCCATTATGAAGCAACGTTTGAAGGTTCTGAGTAGAAATCATTTGCTTTATGAACTATGGAGTAGTTCTCAATTAGGTGT
TCTGGTTTATTTCTCCAGTTCTGCATTTGGTTTGTACTGTTCATAACTAGCTAGACTCTGCTAGTTCTCCATAGATAATCTGGCCCTTTGTCTTGTTGGT
TCGGTGTGTCCTCTTGTAATTTATATGTTTATTAATTAAGTGTCCTTCTGAGTTCTGATGTTGAAATTGTAATTTAGTCTGTAAAATTGTTGTAACATGA
TACAGAGTAATTTCTTTTGATAATCCTGCATTTGATTTAACTTATATTTACTGAACAATAGAATGAAAGTATGAAACTCTATGGCTCTTATGGCATTATT
TTCTCTTTAATTTTGTACAGTCCAGGAACTATGCTATTTCCAATAAATTTTTAGACCGTCTTGCAGGATCCACAGTTTTGAAAGTTGCCCTACTCTTCTA
ACTTGGTAGATAACTGAAGTTTACAGTGTATGCTATTTTTGCCTAGGCTCATAAAAGATAGATTTCTTGATGTTTTTTTTAAAATGCTTTATAGGAATTA
TCATAGACTATAATCATATGTACAGGCTTTTAAGTTGAACTTTGTTACTAGTCACTTTGACACCATATTTCAAAGTATATCATACATTATCACTGTTACA
CTAAATAAATCTTTCTGCTAACTTGCTCAGATTCATCCCCCTTGGTATTATAATCTTTTTATTTCTTCTTACAGTTTGTCTGGTACATTGGCTTTTTTGT
TCCTTATTCAGCATAGTCTCCCTACTTTTAAGATTTGCCAAGAAAGTACCTTAAATAAGAGAATGTATTGTTTGACTGTTGTTAACACCATCATCTTGCA
TGCATATGGATGTGCTTGAATGGGTGAGTGCCCTTTCCCTTGTATAATGTTGTGCAGTTCATTGAGAATGTGTCACGGTTTCATTTATTTTATGGTGAAT
ATTTATGTATGTCAAATGCATGCTTATTAGTTTTGTTAGCTTTTCATAGTTCTACCAATGTATCGATTTTATTATATGTTTTGAAGATAAATTTAGCTCA
ATTTTTATGTAGATTTATTCCTTAATCTGTTCTATATGTACCTGCATGCGTGGAACTTCCATTTTATTATAGTGTGGACCTTGCATGTTCTTGTTCAATT
GTTAACAGACTTTCTTAGTTCCAATTTTGTCCTTGGGTTTAATTTGTTGCGTCATTTTTCTTCTCTGGATAAGCTAGGGCAATCACTAACTGGTTGTTTT
TCTTTTGTCTATGAACTATGATTGAAGTCATGCAAGGTTTTCGTTTTATTTATCTATTATAGTGGTTCATTCATTTATATTTGTTTAGAATTTTAGTTTT
GATTTTATCTACTGAAATGCCTTCTCAGTAAGAACATTGTCTG