Detailed information on CNT30604745


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697368Oryza punctataOryza sativa25.843.696.4785forward
CNT30110563Oryza punctataOryza longistaminata87.2312.4292.33287forward

Expression of CNT30604745

Peptides detected in this lncRNA

>peptide 1 (36 aa)
RNDFVMRLSIAYTQCPLCTSPWISKGKKKEEAEKNS*

Sequence

>CNT30604745
CAGAAATGACTTTGTGATGAGATTGTCAATTGCCTATACACAATGCCCACTCTGTACATCCCCATGGATTAGCAAGGGAAAGAAGAAGGAAGAGGCAGAG
AAGAACAGCTAATTCCCTCATTCATTGCTTAACACCTTATGTGATACAGCATGCTGTCCTTATAGTCTATTCCAGCCAGTAGTTAGCTAGACCTGGCCTG
AGCACCTCTCACATATTACAAGGCTCACTGGCCCTCCACCCACACTCTCAGTTATAATCTTCATTCAGTGTCCTGCCTACCTTGCGTCCTCCTTGCTGGC
CATTGCCTCTAGTATAACTGCAACACAGC