Detailed information on CNT30604656


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001085, E-value = 6e-114

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696801Oryza punctataOryza sativa49.5332.3194.3263forward
CNT30117774Oryza punctataOryza nivara38.7928.7396.6206forward

Expression of CNT30604656

Peptides detected in this lncRNA

>peptide 1 (37 aa)
VLRVSFPVRSWLPAPGHVWGYIRRSCLKGSKSKQNLP*

>peptide 2 (48 aa)
MGKRKKAGRLLVRGLRLKIFLLLWHHIGYVPFAYTSGPHPLSWGSFRI*

>peptide 3 (48 aa)
SFESFFPCEKLAPCSRPCMGLYKEKLPKRIKKQAKPSLTKAMDVRRTP*

Sequence

>CNT30604656
AGTTTTGAGAGTTTCTTTCCCTGTGAGAAGTTGGCTCCCTGCTCCAGGCCATGTATGGGGTTATATAAGGAGAAGCTGCCTAAAAGGATCAAAAAGCAAG
CAAAACCTTCCTTGACTAAAGCAATGGACGTGAGAAGAACTCCTTGAGCTTTCAGCCCAGCTAATGAGGAGTTCAGGCACCAGGCATACACGTGGTTGAT
TACTTGGTTCAAACTTCAGACCAAACTACGGGTAAGCAGAAAAATCAAAAGAGCAAAAATGGGAAAAAGAAAAAAGGCAGGCAGGTTGTTGGTGAGGGGC
TTAAGGCTTAAGATCTTCCTTTTGTTGTGGCACCACATTGGCTATGTCCCTTTTGCTTATACCTCGGGGCCACACCCTTTGAGCTGGGGATCATTTAGAA
TCTAAACAAACCAATAAAAAGTCCCTTCCATTGACAGATTCAGAGTTCAAGAGCATGGTGGCCCCAGGTGATGGCTGGGGCCTCTGATGTGTGATGAGAC
TAATCTGATGTGTAAAACTGCTCGCTTTCCG