Detailed information on CNT30604528


BLAST search results

BLAST vs Swiss-Prot:
sp|P27521|CA4_ARATH, E-value = 1e-69

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30513114Oryza punctataJuglans regia17.3468.5180.3198forward
CNT30728535Oryza punctataCorchorus capsularis16.7355.3680.1191forward
CNT30487770Oryza punctataOlea europaea11.7329.7181.34134forward
CNT30708773Oryza punctataGlycine max16.4629.9483.51188forward
CNT30224179Oryza punctataHordeum vulgare10.0727.2593.04115forward
CNT30554749Oryza punctataOryza glaberrima32.4921.3596.77371forward
CNT30138628Oryza punctataLolium perenne15.1536.7392.49173forward
CNT30605371Oryza punctataGossypium raimondii10.9549.2182.4125forward
CNT30205828Oryza punctataHelianthus annuus7.5322.3487.2186forward
CNT30684486Oryza punctataTriticum urartu10.0753.7490.43115forward
CNT30347972Oryza punctataEragrostis tef14.2720.0793.25163forward
CNT30596737Oryza punctataOryza meridionalis16.2930.5996.77186forward
CNT30370946Oryza punctataOryza glumipatula29.9527.6597.08342forward
CNT30150529Oryza punctataBrachypodium distachyon10.7730.5285.37123forward
CNT30102887Oryza punctataOryza rufipogon26.836.5297.06306forward
CNT30577292Oryza punctataOryza barthii48.5149.9186.46554forward

Expression of CNT30604528

Peptides detected in this lncRNA

>peptide 1 (72 aa)
MQETITTTHTVSLNLITSISLLPPQFINSLYILHKKETRRTFSIAQSVSDHQPELIKLFRDCLAMKPITRSA*

>peptide 2 (52 aa)
MMVLCHGSDRCCSRLSKGPFCVTLCCTRNPKNASIASLPATTNNDDSEQQIF*

>peptide 3 (31 aa)
QYGFFSFFESMRKDDKKNEALDEQLSIVYPP*

>peptide 4 (35 aa)
MNPIFVRTSGSSIPATPSIAHRPFSGSSARPNGSNP

Sequence

>CNT30604528
CAATACGGATTTTTTTCCTTTTTTGAATCAATGCGCAAGGATGATAAAAAAAATGAAGCACTTGACGAGCAATTAAGCATAGTTTATCCACCATAATTAA
GATCAAGACCATGAGAGATAGCTAGAACACTGCTGCTACCATTTTAGCTTCCCCTGTAGTACTGTACATCAGAAGTTCACCAATCAACTCACCCGGCCTC
ACCATGCATGCAGGAAACAATTACCACAACACACACAGTAAGTCTGAATCTCATCACATCCATCTCTCTCCTCCCCCCCCAATTCATTAACAGCTTATAC
ATACTCCACAAAAAAGAAACAAGAAGAACATTTTCCATCGCCCAATCGGTTTCAGATCACCAGCCTGAACTCATCAAGCTCTTTCGAGATTGTCTGGCTA
TGAAACCAATCACACGCTCAGCCTGACAGCGTCTGGATGATGGTGTTGTGCCACGGGTCAGACAGGTGCTGCAGCAGGTTGTCGAAGGGCCCCTTCTGCG
TCACGTTGTGCTGCACCAGGAACCCCAAGAACGCCAGCATCGCCAGCCTCCCTGCAACAACAAACAACGACGATTCAGAACAGCAAATCTTTTGATAGAA
TCTGAACTGAAACTCAAACTGAACTGTCAATAAAGCTATACTTTCTCCTTCCGTTCCATATTATAAGACGTTTCGGTATTTTCATGCCTCGTCTAGATTC
ACTAACATCTGTACGAACCACATACATGGATGCATTCATGATCCTATTCAAAACACAGGACGTCTTGTAATTACCGTTGGCGAGCTCCTTCTCCTTGGCC
TCAAGGGTGGGCTCGAAGTTGAGGGGGTTGAAGATGCTGCCGGGGTAGCCGCACTCGTGTGGTGGCAGGCTGTAGCTCTTGAAGATTGGGTCCTGGTTGA
CGCAGCCAGGGTTCTTGATGTCCTGCCACCGCCGGATCTCCACGTAGTGGAACAGGATGAACTCGATGACGAACAGCGTCGACGACGAGGCGAAGTAGGT
GGCCTTGCCGGCGTCGTACCACTGCGGCGCGTCGATGAACCCGATCTTCGTCAGAACCTCCGGCAGCAGCATCCCGGCCACCCCCAGCATCGCCCACCGC
CCGTTCTCTGGGTCCTCCGCTAGACCCAACGGGTCAAACCCG