Detailed information on CNT30604510


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Expression of CNT30604510

Peptides detected in this lncRNA

>peptide 1 (32 aa)
IYRQFIHTQFNTDNLRFWPRHYSYTNNSVANN*

Sequence

>CNT30604510
TATATATAGACAATTCATACACACACAATTCAACACAGACAATTTAAGATTTTGGCCTCGGCATTATTCATACACGAACAATTCAGTAGCAAATAATTAA
TACGCGGAGTATATATAGACACACGAGTACGTAGAGCTAGGATATATATAAAATTGTTGTTTCAAATACATGGAGTACGTATTTGACAGTAGCAAACAGC
AGTATAATCAACAGCACCAAAAAGTGATAGTAGTAAATATGATTAATTAAGCAGCTGCAGCGCAACAATAATTAATTAAACAACAAACCCGCGGGCAAGT
ATGCCTGTGTTTTTTTTATCTCGCTCAACATATATAAATATATAGTTTGCATGCATATATGGAGATAGATATATAGTAGCAATGTATTTTGGTTGCATGC
TAGCTAGGGACGGACGACATTAATTAATCGATAAACTGAAGAGATGATGAGATGCATGCATGGAGAGATTTATAGAGCTTAATGAAGCTAGAAGCTTGCT
TAATTAGATGAGGTCGTCCTCCTTGTGGGTCTCGATGACGACGTCGGATTTGGGGTAGGCGTGGCAGGTGAGCACCCATCCGGCGCCCATCTGTTCGTCG
TCGAGGAAG