Detailed information on CNT30604504


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695552Oryza punctataOryza sativa10.8821.594.17223forward
CNT30107123Oryza punctataOryza longistaminata15.0734.4591.59309forward
CNT30577449Oryza punctataOryza barthii25.7635.2990.53528forward
CNT30117429Oryza punctataOryza nivara25.3231.6190.17519forward

Expression of CNT30604504

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MFLSTSFSKLLLLPHEYTNTDLLLALQRPVPVATTILLCSLSSASMNL*

>peptide 2 (38 aa)
MSDGKCTYICVPREVLRPPIRDRARATATLGSMCVSVD*

>peptide 3 (41 aa)
MEISGKLHWTNLGQTSLQDKLGFNFILADWYECHPRKHCAS*

>peptide 4 (53 aa)
MPSSQALRKLIVVIFLKKEKSIVVMRKAQQEDKRTGKPARQAKKTVAWRAWRS*

>peptide 5 (54 aa)
MWWCTICASLMYDSTIESNTHILYFWIYYYSVENKLELYSNTIGNMPVDIALPS*

>peptide 6 (37 aa)
MNAILASIAQVDSGDILEKRKIDSGDEKSTAGGQEDR*

>peptide 7 (35 aa)
MGGARNKIANSHRKLHPYLQVPSADNLSGISVCSC*

>peptide 8 (34 aa)
MLCQMQFVASSWPPCPCVLILVRQTWEFNIAKTT*

>peptide 9 (29 aa)
MLLLNLRVIHICTLPVTSQVFCCLGHNSV*

>peptide 10 (49 aa)
MPAGKVISASFLLKMGRYVKLCLQGWEFDSAYLIPENLCEVRVTSSARR*

Sequence

>CNT30604504
TGAGCTTATGTTGTTTTATGAACTTGCCCATAGTGCAAAAATGAACTAATGTTGTTGTTGAACTTGAGAGTAATACACATCTGTACTCTACCTGTAACAT
CCCAAGTGTTTTGTTGTTTGGGGCACAATTCAGTATAGCCAGCAATGCACCTGATGAAATGGTACACGGCTATTATTGGAGTAGGAAGGTGATGGCTATC
GAGAGCTAAGAAGAACAATGAGTGATGGAAAGTGCACATATATATGCGTACCAAGAGAGGTGCTAAGGCCACCAATAAGGGACAGAGCGAGAGCAACAGC
AACTTTGGGATCCATGTGTGTATCTGTTGATTGATGGATTTATCTCTCCCTGGATAGGTGAGCTTTGGCGTCTACAGCAACTATGGGAGGAAAATGAAGG
TATGCTGTTACTAGAAGAACAGTAGTACTAATAGTAGTATGGGTGGATGGATGGATGATTGTGAAAGGTAAATTAATATCTTCTGTTGCGCTGATGGAGA
TGGATGCACCTTTATATACAGGCGAGGCTGGGTGGCTATGACGTTACGTAGTTATGGAGCTTGTGTTATAGTTGAGCATGTAATTAACAGGCAGCTAACC
AGTTGATTTAATGTGAAAAGTAGGGAGGGGGTTATTAAGTGGAGCATGAGATAACTGGGTGATGCATTAGTTCAGCTAAGTTGAGTGGGGCAAGTCTGGA
ATGACTTGGCACATGCTGCTTGCTTGCTAACTTATGTAATTCATGGGTATCCTCATAGTTAAGCTATGTTTCACTTGAGGTATGCCTGCAGGTAAGGTAA
TTTCTGCTAGCTTTCTTCTAAAGATGGGAAGGTATGTTAAGCTATGCCTGCAGGGCTGGGAGTTTGATAGTGCATATTTAATTCCTGAAAATTTGTGTGA
AGTGAGAGTTACTAGCAGTGCCCGCAGGTGATATGGCATAAGTAACCCAACAGGCGATATGGCAAAGTAACCCCCGTTATTATTCTTGTAATAATATATT
ATGCTCTGCCAAATGCAATTTGTTGCTTCATCTTGGCCCCCCTGTCCCTGTGTACTCATCCTTGTTAGACAAACTTGGGAGTTCAACATAGCAAAAACAA
CTTAGCTAGTGAAATGGAGATCTCAGGGAAGTTGCATTGGACGAATCTTGGTCAGACAAGCCTCCAAGACAAACTTGGATTCAATTTCATTCTGGCAGAC
TGGTATGAATGCCATCCTCGCAAGCATTGCGCAAGTTGATAGTGGTGATATTCTTGAAAAAAGAAAAATCGATAGTGGTGATGAGAAAAGCACAGCAGGA
GGACAAGAGGACAGGTAAGCCGGCACGGCAAGCTAAGAAGACGGTGGCTTGGCGTGCTTGGCGTTCGTAATCTAACTTAAATTACCAGGCAGAGGCAGGC
AAACACTGATCTTTAGCTTGATGGAAGATGTTCCTGTCAACATCTTTCAGTAAGTTGCTGCTGCTACCACACGAGTACACTAATACCGATCTGCTTCTTG
CCCTCCAACGGCCTGTTCCTGTAGCAACAACAATACTGCTCTGCTCCTTGTCATCTGCATCTATGAATCTATGATGATCTATGTGGTGGTGTACTATCTG
TGCTAGCTTAATGTATGATTCCACCATCGAATCGAACACGCATATACTATATTTTTGGATATATTACTACTCCGTAGAAAACAAACTAGAATTGTATAGT
AATACAATAGGCAACATGCCTGTTGACATAGCTCTACCGTCATAACTCATAAGCATGCAGCATATTAATGGGTGGTGCAAGAAATAAAATTGCAAATTCT
CATCGAAAATTGCATCCATATTTACAAGTTCCGTCAGCGGACAATCTTTCTGGGATCTCAGTGTGTTCTTGTTGACAGTAATATACCACCAAGATATTTC
CATCCTTTTAAACTACTGTTAATTAATATCAGTCACTAAACATATATATGTATCCTATATGCACCGCAGGCAATTAGCTATATGTCCTCGATCGTTTAAA
CTAATTAACTACGAGAAGAAGAAACGATGTTCCAATTAAGAAGAGTCTTC