Detailed information on CNT30604352


BLAST search results

BLAST vs Swiss-Prot:
sp|P10707|CB2D_SOLLC, E-value = 1e-19

BLAST vs NONCODE: nothing found

Expression of CNT30604352

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MARRACLISASCSRSFFSGSDANPSGSKYDPPGYDDPSTSST

>peptide 2 (56 aa)
NICFVHVCIHNHTHLVKYQDQSIDVQVDALIHHLQCSYITNHHHAFKSPLTTNQLS*

Sequence

>CNT30604352
AAATATATGCTTTGTGCATGTGTGCATTCATAATCACACTCACCTAGTCAAATACCAAGATCAATCGATCGATGTACAAGTGGATGCATTAATTCATCAT
CTTCAGTGTTCATATATTACAAATCACCACCATGCATTCAAGTCGCCATTAACCACCAACCAGCTCTCCTAATTTAAGCAGTAATCAACAAAAGGATGAC
CTCTCGCCATACTCTTCCTCGCTCGTCATCACAAAACTAAACCGCGCGTACGTACGCGCGCGCGCGCGAACGCACACCAACGCACGCAAACGCGTCGATC
CCATTTGAATTGCGCGCGAAGTTTTTTAAGAGGAGGAGAAGGTGTCGAAGATGGTGGTGTGGAGCGGGTCGCTGAGGTGAGTAGCCCAGTTGTTGAGGGG
GCCCTTGCCGGTGGCGGCGGCCTGCACGGCGAAGCCGAGGAAGGCGACCATGGCGAGGCGGGCGTGCTTGATCTCCGCCAGCTGCAGCCGCTCCTTCTTC
TCCGGGTCCGACGCCAACCCGAGCGGGTCGAAGTACGATCCCCCCGGGTACGACGACCCATCCACCAGCTCCACCT