Detailed information on CNT30604287


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30513550Oryza punctataJuglans regia18.5824.1985.71105forward
CNT30589797Oryza punctataMusa acuminata17.742.0286100forward
CNT30554232Oryza punctataOryza glaberrima59.6545.9891.69337forward
CNT30147799Oryza punctataBrachypodium distachyon24.2519.3286.86137forward
CNT30117019Oryza punctataOryza nivara91.3375.8891.28516forward

Expression of CNT30604287

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MHILIQQIYLIIAKIYPLSSSLQNAITIYVATNQRSQHNTILS*

>peptide 2 (43 aa)
MASYVEGESASASAISDASVTCQWASQALDPGSQQSQPFSPYPC

>peptide 3 (92 aa)
MSLPKSDKLENSTTTVTSSHNHAHPNTTDLPYYCKDISPLIFSTKCNNNICSNESKVPTQHNPFLTKTTLHHSWRTSVPDTQPSPLCPRGNH*

>peptide 4 (31 aa)
MQIKYTYEFTKIRQTGKQYNHRHIIAQPCTS*

Sequence

>CNT30604287
TTTGAAAAAAATAATAATATATGCAAATAAAATACACATATGAGTTTACCAAAATCCGACAAACTGGAAAACAGTACAACCACCGTCACATCATCGCACA
ACCATGCACATCCTAATACAACAGATTTACCTTATTATTGCAAAGATATATCCCCTCTCATCTTCTCTACAAAATGCAATAACAATATATGTAGCAACGA
ATCAAAGGTCCCAACACAACACAATCCTTTCTTAACAAAAACAACACTACACCATTCGTGGCGCACATCCGTGCCTGACACTCAGCCTTCTCCTCTGTGT
CCTAGAGGAAACCATTAGCAGCTGAGCCAAGCCGTTATCACTCAGGGGCGTCCTTGCTAGGTGCCGCAGCTACCTTGGTTCCATCCTTTCCTGCAGCACC
ATCCTTACCGGCAGCTGCAGCGGGCGGGGGAGATGGCTTCATATGTGGAGGGGGAGAGTGCTTCAGCTTCAGCAATATCTGACGCATCCGTGACATGTCA
GTGGGCTTCCCAGGCTTTGGACCCTGGATCACAACAATCCCAGCCTTTTTCTCCTTATCCTTGTC