Detailed information on CNT30604257


BLAST search results

BLAST vs Swiss-Prot:
sp|O81831|CARP1_ARATH, E-value = 5e-21

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694421Oryza punctataOryza sativa21.4228.7896.4139forward
CNT30474988Oryza punctataSaccharum spontaneum26.3530.8791.23171forward
CNT30140798Oryza punctataLolium perenne36.5239.388.61237forward
CNT30148179Oryza punctataBrachypodium distachyon19.7237.5493.75128forward
CNT30583063Oryza punctataEchinochloa crusgalli38.6728.8592.83251forward
CNT30116889Oryza punctataOryza nivara41.7641.1289.3271forward

Expression of CNT30604257

Peptides detected in this lncRNA

>peptide 1 (96 aa)
MNCEAWATASSSHRRGSSMRTQNSISLSAPSPSKSPSASIPLRSSSDIPPSPSSGALRRRLSKVMSPDAGSMSSRNPLASSCISPSSPSLSAITGR*

>peptide 2 (31 aa)
MNPDAMNNEKKEERKKKKINPMHVELMKDEL*

>peptide 3 (30 aa)
WMNTSNEKKKLADQLIQIPVGTKNEQSTTT*

Sequence

>CNT30604257
TGGATGAACACCAGTAATGAGAAGAAAAAGCTTGCTGATCAATTAATTCAGATTCCAGTTGGAACAAAGAACGAGCAGAGTACTACTACATGAGAAGTAC
AAATGTGATTGGAATCCGTGAACCAATGAGCAGTGCCCTTGATGAATCCTGATGCTATGAACAACGAGAAGAAAGAAGAAAGGAAAAAAAAGAAGATTAA
TCCTATGCACGTCGAACTAATGAAAGATGAACTGTGAGGCCTGGGCGACGGCGTCGTCGAGCCACCGGCGAGGCTCGTCCATGAGGACGCAGAACTCCAT
CTCGCTGAGCGCGCCGTCGCCGTCGAAGTCGCCCTCGGCGAGCATCCCTCTCAGGTCGTCGTCGGACATCCCGCCGAGCCCGAGCAGCGGCGCGTTGCGG
CGGAGGCTGTCGAAGGTGATGAGCCCCGACGCCGGGTCCATGAGCAGCCGGAACCCGCTTGCGAGCTCCTGCATCAGCCCTTCCTCCCCTAGCCTCTCCG
CCATCACTGGCAGGTAGTCCTCGAACCCCTCCTGCATCTGCTGATCCGCCGCCATCCTAGTGAGTGACTGATCGATCGATTTGTTGATTGATTCCGGTGT
TCTGTTTGCTTCTTGTGATCTTTGAGAGGAGGAGGAGATGGATGATTTG