Detailed information on CNT30604219


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30604219

Peptides detected in this lncRNA

>peptide 1 (65 aa)
MCAGIPTSFALDPSKTAIDAVPLLSVQITGLMVPTGVVPLISVPTSGLPVADSAVESMVTSGAIE*

Sequence

>CNT30604219
CCGGCGGGTGTTCTATCTTCTGATTCAGCTAATGTTGGAATCTGAGTGCTCACGACAGTATTATTTTCTTCAGTAGCAGCACCTGACGGGCTAGTCGTTT
CGTTCGGCTGCTCTAGCTTTGCCTCCGATATTCCTGCTGGGATTTGCACATCAGCAGATACATCGGTGGCATCAGATATTGGCGTTGGTGGATGAGGTGC
TGAACTGGATACAGGTTCATGAACAATGTGTGCTGGTATACCAACCTCCTTTGCATTAGACCCTTCCAAAACAGCAATTGATGCGGTACCCTTATTGTCG
GTACAAATCACTGGTTTGATGGTACCAACTGGTGTAGTACCCTTAATCTCAGTACCAACCTCTGGATTGCCGGTAGCAGATAGTGCAGTAGAATCAATGG
TAACATCTGGAGCAATCGAATGAATGGTAGTAGTTGGTGCAGAAGAACTGCCATCAATTATAGTTCCTGCCTCTTGTTTGCCA