Detailed information on CNT30604205


BLAST search results

BLAST vs Swiss-Prot:
sp|Q5Z974|FTSH1_ORYSJ, E-value = 4e-37

BLAST vs NONCODE:
NONMEST004776, E-value = 2e-38

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694482Oryza punctataOryza sativa15.5334.9897.91191forward
CNT30673684Oryza punctataSetaria viridis17.3248.390.14213forward
CNT30307627Oryza punctataTriticum aestivum6.6722.9785.3782forward
CNT30242892Oryza punctataAvena sativa10.8932.8486.57134forward
CNT30217668Oryza punctataKalanchoe fedtschenkoi7.7226.6986.3295forward
CNT30102047Oryza punctataOryza rufipogon26.565.7388.65326forward
CNT30576812Oryza punctataOryza barthii20.5756.2285.77253forward
CNT3050155Oryza punctataCucumis sativus6.0227.1185.1474forward
CNT3040375Oryza punctataMarchantia polymorpha5.8525.0987.572forward

Expression of CNT30604205

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MLSLLKFARLVLQLIFTDSAPTIRSFSFFDSLFQL*

>peptide 2 (49 aa)
MKNIMLPFTQILRIADRNSEKQSQRRLARLPRLAGQPVSTHSHTKELCA*

>peptide 3 (79 aa)
MKQLQLQQVFRADDDVQQVWKHVLVSDAIIVSTNSLLAQCQYMPSLQCTIQVCKNSSPKSMWFLQFVFSISFGTSNPRG*

Sequence

>CNT30604205
TGAGAGAACAGTAGTAATATGAAGTTTCGATGCCGATCAGTAAATCTGGATTAAAACAAAATCCACACGGATGAAACAGCTGCAACTGCAACAGGTCTTC
CGTGCAGATGACGATGTACAGCAAGTTTGGAAACATGTTTTAGTTAGTGATGCTATAATCGTAAGCACCAACAGTTTACTTGCTCAATGTCAGTATATGC
CTTCTTTACAATGTACTATACAAGTATGCAAAAACAGCTCGCCTAAATCGATGTGGTTCCTACAATTTGTGTTCTCCATTTCCTTTGGTACGAGCAACCC
AAGGGGATGAACATACGACGAATTTAAGCAACAAACAACTCTGCCTGGCCGTCAATGAACAGGCTCATGAACTCTTCCCCGTCCACCGTCTCCTTCTCCA
TCAGAAGCTGAGCAAGCTTGTGGAGGATGTCGATGTGTGTCGTGATGATCTGCGTTGCTCTTGAGTAGGCCTTCTCCACGAGCTCCCTCACCTCAGCATC
CACAACATCGGCGGTGGCCATCGAGTAGTCCTTCTGGCTCGACATCTGCAACCAAAGGATATGAAAAATATCATGCTACCATTCACACAGATACTACGAA
TTGCCGATAGAAATTCCGAGAAGCAAAGCCAACGCAGGTTAGCAAGATTGCCACGTCTGGCAGGGCAACCAGTATCTACTCACAGCCACACAAAAGAGTT
GTGTGCCTAATTGGCGCTACTCTTTGATTTTGTCTCTGCTTTTATAGACTAAGTGTGTTGATGATGACAACATTGGCAGTATATGACAATGTAGAGTGGC
GAGTTACATGAATGCACTAGACTATGCTATTCATCAAGGTTAAAGGAACAAACTGAACTTACGGAGATGGACCTTCCCCATAGGACAGTAGAGACTTCAG
AACACTAGATGCACACGAGGACAAGAAAGGTTGGGCTCATATGTTGTCATTGTTGAAGTTTGCACGTCTAGTTCTTCAATTAATTTTTACAGACTCTGCT
CCTACGATTAGAAGTTTTTCTTTCTTTGATAGTCTGTTTCAGCTATAGTTATTTACCTGCTGGCCCAAGAAAGGATTTCCACCAGGTCCACCAATCGCAA
TTTGCCCGATTTTCTTGCTGAATCCAAATCTTTCAACCATTTGTCTTGCAACACGTGAAACCTGCATGAAGTCATTAGAGGCCCCAGTTGTCACATTTTC
TTGGCCAAAGATCACCTCTTCAGCAACCCT