Detailed information on CNT30604161


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693527Oryza punctataOryza sativa5058.2990.24369forward
CNT30553706Oryza punctataOryza glaberrima93.2295.6988.95688forward
CNT30116837Oryza punctataOryza nivara93.2298.4388.66688forward

Expression of CNT30604161

Peptides detected in this lncRNA

>peptide 1 (38 aa)
WEAKCVLGQEDFNIKQIMGQTMQPYLTKIRMLSLHNTH*

>peptide 2 (59 aa)
MLAVTTSSSTSKSSNRPHERFSEVWQLGAAAGKSSTMCIVQRESPDGKTADKVVLSYVD*

>peptide 3 (38 aa)
MWTDPWDNAKIDCLAKDMHRIILCLEQRYHPYLHNFHC*

Sequence

>CNT30604161
CTTGGGAGGCAAAATGTGTATTGGGACAAGAAGATTTTAACATTAAGCAAATAATGGGCCAAACCATGCAGCCTTACTTAACAAAGATTCGAATGCTGTC
ATTACACAATACACACTAGTTTGATGAACAAACTTTATTCAGCAGCAATAGGTAAATAAGATAATACAAAGCGATTGATCCTCAGTAGTGCACCAGGCTA
GACAGGTGCTTGGATCATAGAGCTTCGCCATCGAGAACTATGCCAAACCTTCAAAGCAGCAGAGAACATTGTTGGCCTCACAATGCTTGCAGTGACCACC
AGTTCGAGCACTAGTAAATCCAGTAACCGTCCACATGAAAGATTCAGCGAGGTTTGGCAGCTCGGAGCGGCAGCAGGTAAATCATCAACAATGTGCATAG
TCCAACGGGAGTCACCAGATGGAAAGACAGCAGATAAAGTAGTATTGTCATATGTGGACTGATCCATGGGATAATGCCAAAATTGATTGTTTGGCAAAGG
ATATGCATAGGATAATCTTGTGTCTGGAGCAAAGATATCATCCATATTTACATAATTTTCACTGCTAGGAACTCCAACGTATGTGGGCTGTGAAGTGTGT
TGTTCAGTAACACCAGCATTGGGTAGAGAAAAACCATCATCATTTGGCACGTCCAATTCAGCAAGCCCTGCAATTTCATTGTATAGATCATTTGTGTTAA
CTTCAAAAGCATGAGCTTCAGCTTCAGACATTGGTGGG