Detailed information on CNT30604148


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 1e-156

BLAST vs NONCODE:
NONMEST001181, E-value = 4e-107

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553681Oryza punctataOryza glaberrima86.4167.5691.52731forward
CNT30461176Oryza punctataSaccharum spontaneum80.6120.0188.56682forward
CNT30370375Oryza punctataOryza glumipatula87.8377.8892.46743forward
CNT30110940Oryza punctataOryza longistaminata10031.1989.6846forward
CNT30576527Oryza punctataOryza barthii87.8384.0592.6743forward
CNT30583684Oryza punctataEchinochloa crusgalli80.6132.4987.54682forward

Expression of CNT30604148

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MPSLSWILAFTLSMVSELSTSRVMVLPVRVLTKICIPPLRRSTK*

>peptide 2 (40 aa)
MRRCWSGGIPSLSWILALTLSMVSEDSTSRVMVLPVRVFTK

>peptide 3 (52 aa)
MSLCWSGGMPSLSWIFAFTLSIVSDDSTSSVMVLPVRVFTKICIPPLRRRTR*

>peptide 4 (64 aa)
MKGGLLLDVVVSKSAAIFELLASKDETLLVRRDSLLVLDFGLDVINGIRGLNLKGYGLASESLHE

Sequence

>CNT30604148
GACTGCTGTGACACAGCAAATGCTCGAACAGCAGTAGAGCACATTTAAACGGACTCGATGGTCCACTAAGGAATAAGGAAAGACGGGTGAAACAGCATTA
TGAAAGTTTTCACGAGGATAACGCAGACACAGGACGACAGTGAGGCAGCAATTCCATCAACGATTTACTGACCACCCCTGAGGCGGAGCACCAGGTGGAG
AGTGGACTCCTTCTGAATGTTGTAGTCGGCAAGGGTACGGCCATCTTCCAGCTGCTTGCCAGCGAAGATCAGGCGCTGCTGGTCCGGGGGGATGCCTTCC
TTGTCCTGGATCTTAGCCTTCACATTATCGATGGTGTCGGAGCTCTCAACCTCCAGAGTAATGGTCTTGCCAGTGAGAGTCTTGACAAAGATCTGCATAC
CACCCCTGAGGCGGAGCACCAAGTGAAGGGTAGACTCCTTCTGGATGTTGTAGTCGGCAAGGGTGCGGCCATCCTCCAGCTGCTTGCCAGCGAAGATGAG
TCTCTGCTGGTCTGGGGGGATGCCCTCTTTGTCCTGGATCTTCGCCTTCACGTTGTCAATCGTGTCTGATGACTCGACCTCAAGCGTGATGGTCTTGCCA
GTAAGGGTCTTCACGAAGATCTGCATTCCTCCCCTGAGGCGGAGGACAAGATGAAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCAAGAGTGCGGCCAT
CTTCGAGCTGCTTGCCAGCAAAGATGAGACGCTGCTGGTCCGGAGGGATTCCCTCCTTGTCCTGGATTTTGGCCTTGACGTTATCAATGGTATCCGAGGA
CTCAACCTCAAGGGTTATGGTCTTGCCAGTGAGAGTCTTCACGAAG