Detailed information on CNT30604147


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30474046Oryza punctataSaccharum spontaneum17.1630.4993.3375reverse complement
CNT30370244Oryza punctataOryza glumipatula32.0427.7891.43140forward
CNT30576332Oryza punctataOryza barthii32.0431.7590.71140forward

Expression of CNT30604147

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MASFWFSLALAGKERSLVWGLEGEETALIFFL

>peptide 2 (29 aa)
MHGPVIQPLLLMNTRHLARTHPPNYSNNS*

>peptide 3 (30 aa)
MPHHAWPGDPTTTTDEHETLSTHAPSKLFQ*

Sequence

>CNT30604147
TTCAATTGCGATTCGATTACGGTTGAGATAAGATAAATCGGTGTAGGCCAAGAAGCGAAACCGACGACTCCAAACATTGGCAAAAGTTAAAAAAGACAGA
TGATGATATATCTACATGCCCCACCATGCATGGCCCGGTGATCCAACCACTACTACTGATGAACACGAGACACTTAGCACGCACGCACCCTCCAAATTAT
TCCAATAACAGCTAGGATTGCGAGGGGACGGACACCGACCGATCGACACCGGGCGGGGCGGGGGGAGGCCGACTTGCGGTCGCTGCGGTAGTCCGCCGGC
GCCTTGTGCGGGTTCCGGCTCTTCTTCGCGCCGCCGTCCATGGCGAGCTTCTGGTTCTCTCTCGCGCTCGCGGGGAAGGAGAGGAGTTTGGTTTGGGGAT
TGGAAGGAGAGGAAACTGCTCTGATTTTTTTTTTGGG