Detailed information on CNT30604138


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 1e-156

BLAST vs NONCODE:
NONMEST001181, E-value = 3e-120

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693795Oryza punctataOryza sativa87.8377.5694.75743forward
CNT30553813Oryza punctataOryza glaberrima87.8379.4795.15743forward
CNT30370352Oryza punctataOryza glumipatula79.4356.7694.49672forward
CNT30116852Oryza punctataOryza nivara79.4356.5795.83672forward

Expression of CNT30604138

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MSLCWSGGMPSLSWIFAFTLSMVSELSTSRVIVLPVRVLTKICIPPLRRRTRWRVDSFWML*

>peptide 2 (64 aa)
MKGGLLLDVVVSKSAAIFELLASKDETLLVRRDSLLVLDFGLDVINGIRGLNLKGYGLASESLHE

>peptide 3 (40 aa)
MRRCWSGGIPSLSWILALTLSMVSEDSTSRVMVLPVRVFTK

>peptide 4 (44 aa)
MPSLSWIFALTLSMVSEDSTSRVIVFPVKVLTNICMPPRRRRTR*

Sequence

>CNT30604138
GACTGCTGTGACACAGCAAATGCTCGAACAGCAGTAGAGCACATTTAAACGGACTCGATGGTCCACTAAGGAATAAGGAAAGACGGGTGAAACAGCATTA
TGAAAGTTTTCACGAGGATAACGCAGACACAGGACGACAGTGAGGCAGCAATTCCATCAACGATTTACTGACCACCCCTGAGGCGGAGCACCAAGTGGAG
GGTAGACTCCTTCTGGATGTTGTAGTCGGCAAGGGTGCGGCCATCCTCCAGCTGCTTACCAGCGAAGATGAGTCTCTGCTGGTCCGGGGGGATGCCCTCC
TTATCCTGGATCTTCGCCTTCACGTTGTCGATGGTGTCTGAGCTCTCAACCTCCAGGGTAATAGTCTTGCCAGTGAGAGTCTTGACGAAAATCTGCATTC
CACCCCTAAGGCGCAGAACAAGGTGGAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCAAGGGTCCTGCCATCCTCAAGCTGCTTGCCAGCAAAGATCAG
ACGCTGCTGGTCTGGGGGAATGCCCTCCTTGTCCTGGATCTTTGCCTTAACATTGTCAATGGTATCAGAGGACTCCACCTCAAGGGTGATAGTCTTTCCG
GTCAAGGTCTTGACAAATATTTGCATGCCTCCCCGGAGGCGGAGGACAAGATGAAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCAAGAGTGCGGCCAT
CTTCGAGCTGCTTGCCAGCAAAGATGAGACGCTGCTGGTCCGGAGGGATTCCCTCCTTGTCCTGGATTTTGGCCTTGACGTTATCAATGGTATCCGAGGA
CTCAACCTCAAGGGTTATGGTCTTGCCAGTGAGAGTCTTCACGAAG