Detailed information on CNT30604129


BLAST search results

BLAST vs Swiss-Prot:
sp|P20121|PSAH_PEA, E-value = 2e-18

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693422Oryza punctataOryza sativa36.5232.394.32229forward
CNT30673198Oryza punctataSetaria viridis19.1452.6394.17120forward
CNT30532753Oryza punctataEucalyptus grandis15.9540.3284100forward
CNT30285918Oryza punctataTriticum aestivum17.2222.9888.89108forward
CNT30384456Oryza punctataTriticum turgidum17.2220.1988.89108forward
CNT30591852Oryza punctataMusa acuminata15.3123.0292.7196forward
CNT30435366Oryza punctataAegilops tauschii17.2223.7489.81108forward
CNT30240454Oryza punctataAvena sativa17.2230.6891.67108forward
CNT30655703Oryza punctataTriticum dicoccoides17.2230.0889.81108forward
CNT30131217Oryza punctataLolium perenne17.2221.6493.52108forward
CNT30679604Oryza punctataTriticum urartu17.2232.1489.81108forward
CNT30338878Oryza punctataEragrostis tef21.5317.3192.59135forward
CNT30370255Oryza punctataOryza glumipatula36.5235.9594.32229forward
CNT30149479Oryza punctataBrachypodium distachyon15.7925.7190.9199forward
CNT30101773Oryza punctataOryza rufipogon36.5227.7993.89229forward
CNT30576447Oryza punctataOryza barthii29.0360.6793.41182forward
CNT30496573Oryza punctataDigitaria exilis21.692592.65136forward
CNT30116717Oryza punctataOryza nivara36.5227.8694.32229forward

Expression of CNT30604129

Peptides detected in this lncRNA

>peptide 1 (31 aa)
DPAMGTSSTVQRIAWMDQIKKKVRQRQKRGI*

Sequence

>CNT30604129
GATCCGGCCATGGGGACTAGCAGTACAGTACAGAGGATTGCATGGATGGATCAGATCAAGAAGAAGGTGAGGCAGAGGCAGAAACGAGGAATTTAATTTA
GATCTTGCCGCGTGGCCCGGGCGTCGGCGGCAGCTGCGGGCCCTTCTTGATCGGCAGCAGGAACTTGAGCAGGAGCCCCCTCTTGGTGAACGGCCCCGCA
AACGTCTCGAAGAACTTGCTCTGCATCACCCACACAAATTAGTAATTTATCATCCAAGATGCACTTGATAATATAACAGTAAGTACGTGATTTCGACCCT
AAGATCTCCTGTTCAATCCCTAAAATACTTACAATTTCTAAAAAAAATATATACATAAGGTTTCATATTAAATTCTCGAGACGCTATAATTTTTTTAAAA
AAAAGGTTTGAAGGAACATCTCGTCCTTCAAATCTCGATTAATTTAGTCACCTACCTGAAGAGGGTTGTACGGCGACGGCGCGTCGGAGCCGTACAGGTC
CCACTGGCCGGTGGTGTTGCCGATGTCGTCGAGGTCGAAGTAGACGCTCTTCTCGCCGTACTTTGCCACCACGGCGGCGCGCGGCCTGCAGTTCACACGC
AAAGTTAATTAACCACTCACTTACTCC