Detailed information on CNT30604109


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553663Oryza punctataOryza glaberrima99.7398.9293.81096forward
CNT30474047Oryza punctataSaccharum spontaneum13.7427.7680.79151forward
CNT3067525Oryza punctataLeersia perrieri46.2260.5587.01508reverse complement
CNT30596287Oryza punctataOryza meridionalis24.1150.8695.85265forward
CNT30370326Oryza punctataOryza glumipatula100.6499.7393.581106forward
CNT30101746Oryza punctataOryza rufipogon98.27101.3193.061080forward
CNT30576582Oryza punctataOryza barthii59.1457.8895.08650forward
CNT30116754Oryza punctataOryza nivara100.82100.5492.871108forward

Expression of CNT30604109

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MVTERRRGGVQMSISTKAMIAATRSPMRLKAASSSDSSLQHILPMSAPAEKDQEQISWW*

>peptide 2 (44 aa)
MPGLPAFSPTTFTLHIFDSSEKQSSFSHQRTHSPAGTTPPQQQG*

>peptide 3 (35 aa)
MVPFPYNSFSSSKMVRRQLSQPISTHPRTLNTGLG*

>peptide 4 (31 aa)
MKVAARRRRGLLGKGLPWCHSLIIHFHLPRW*

>peptide 5 (30 aa)
MTSCCCSDVNSAAGDFVAVNLMMVADGEMR*

Sequence

>CNT30604109
TATTTCCAAAGCTATCAATTCAGGCTAAAGATAAAAGAGACTATTATACCAATAAACATGACTTACAGTAGGATGCATTACAATTAAGCAATTATTTAAC
TTGAAAAATCAGGAGCCAATGCCTGGCCTGCCTGCTTTCTCTCCAACAACCTTCACCCTGCACATCTTTGATTCTTCAGAGAAGCAATCAAGCTTCTCCC
ATCAAAGGACTCACAGTCCTGCAGGTACTACTCCACCTCAGCAGCAAGGGTAGATGGTGACTGAGCGCCGCCGTGGCGGCGTGCAGATGAGCATCAGCAC
CAAGGCGATGATCGCGGCAACGAGAAGCCCCATGAGGTTGAAGGCGGCTTCCTCTTCGGACTCCTCGCTGCAGCACATCTTGCCCATGTCAGCACCGGCA
GAGAAAGATCAAGAACAAATCTCTTGGTGGTAGGTAGTATGTTGGAGCAAGATGAAAGTGGCAGCTAGAAGAAGAAGAGGGCTTCTTGGCAAAGGTCTCC
CATGGTGCCATTCCCTTATAATTCATTTTCATCTTCCAAGATGGTGAGAAGACAGCTCAGCCAGCCAATCAGCACCCACCCAAGGACTCTTAACACTGGC
CTGGGATGAAATTTCTGGGATGACCAGTTGCTGCTGCTCAGATGTAAATTCTGCTGCTGGTGATTTTGTCGCAGTCAATTTGATGATGGTTGCTGATGGT
GAGATGAGATGAAAACTACACCATGGATGCACTAATGATACTCCTGGTGAACTTGAAAGTTCAGAGATCTTACTTTCTGAAGGTTGTTGAAAAGTAATTC
ACTTCTTCAGTGATGGAAGTCCTGGAAACAAAACAAGGCTGATTAGCATTTGCTGATGGCTACATTTCATTCCCTGTGAAACACATCTCATTCAGCATTT
GAGGTAGTAGCAAACATTAGGTGGCACATGTTGTGTGTCGGTGTGACTTAGACCTGCAATGAGTTGCCTTTAAATAATCTGGCACATGTTTTTCGGGAAG
GTGAAGCATGGCAACATGTCTTGTTCCAATACAACTCTTGTATTCATCTATTTATTTACCCTATGAAATTCCATGCATCTTTTTGTGACTAGAATACAG