Detailed information on CNT30604049


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CG83|UBIQP_HORVU, E-value = 6e-90

BLAST vs NONCODE:
NONMTRT002043, E-value = 4e-56

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30604049

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MTDERHRHNEFQRCITAHAQRPPRRRRTRCRVDSFWML*

>peptide 2 (30 aa)
MVLPVRVFTKICIPPRRRRTRCKVDSFWML*

>peptide 3 (32 aa)
TRNSGRLRPCEQCTNRISSRIKHLKTLAEVEG*

>peptide 4 (35 aa)
MHKQNLISDQTSQNISRSRRIIASIGTHAQLSKLY*

>peptide 5 (48 aa)
MVLPVRVLTNICIWKQRIGINIKLEKKKQLEHKLASDSTISILSAHNR*

>peptide 6 (50 aa)
MLLMEREPLYIKRGQGGARQQPVRSPPRVQPNGSATRGPVVVARHVSGPGT

Sequence

>CNT30604049
ACGCGCAACAGTGGCCGGTTACGACCATGTGAACAATGCACAAACAGAATCTCATCTCGGATCAAACATCTCAAAACATTAGCAGAAGTAGAAGGATAAT
AGCATCGATTGGTACCCATGCACAGTTAAGCAAATTGTACTAGCATGGATTATAATATTTGTCCAGAACGGCTTCCAACTTCATAGGCCCTACTACGGCC
TTGCACACATGGTGCATACCAACAACTTAGGGACTCTAAACCAGAAAACAACTCAACCATGACACGACGATATGACAGACGAGCGGCATAGACATAACGA
ATTCCAACGCTGCATCACAGCACACGCTCAGAGACCACCACGGAGGCGCAGGACAAGGTGCAGGGTGGACTCCTTCTGGATGTTGTAGTCTGCAAGGGTA
CGTCCATCCTCAAGCTGCTTGCCGGCAAAGATGAGGCGCTGCTGATCTGGTGGAATACCCTCCTTGTCCTGGATCTTGGCCTTCACATTGTCGATTGTGT
CAGAGGACTCAACCTCCAGGGTGATGGTCTTGCCGGTGAGGGTCTTCACGAAGATCTGCATACCTCCACGAAGGCGGAGGACCAGGTGCAAGGTGGACTC
CTTCTGGATGTTATAATCCGCAAGAGTACGCCCATCCTCAAGCTGCTTGCCAGCGAAGATAAGGCGCTGCTGGTCCGGAGGGATGCCCTCCTTGTCCTGA
ATCTTAGCCTTCACATTGTCAATCGTATCGGAGGACTCAACCTCCAAGGTGATGGTCTTGCCAGTGAGGGTCTTAACAAATATCTGCATCTGGAAACAAA
GGATTGGAATCAACATAAAGTTAGAAAAAAAAAAGCAGCTGGAGCATAAGTTGGCATCAGATTCTACGATATCGATACTGTCAGCTCATAATAGATGAAC
ATATCAATCACATCATAAAACACTACAATTGGAGAGCATTATTAATCATAAGAGAGCTGCTCACACCTCATCAACAAGCAACTACCAAATATCTTCAGAT
AACAAAACTGACATAAGCAACTACAGGACACGACAGATCTATGTAAGAATACAGAATAGAGCCACCTAGTTCTAGCATGCAACAGATTTGATTTGTACGA
GTAAAGCAAATAAAACGGTAAAAAGCACTACAGTTCAACTAGGCAAAGAGCCAGATACGATACAGATTAAATTGACCGTAGAACCCAACCTCTACAGTTC
AAGTAGGTGCGCACGATAAAGATGTAATTCTCTAACCCAGCTCCACACAATTCCAGTCTAAGGGGAAAAAAACTAAGTGTCGCTAACTCAACAACCTGAG
GATTTTAACAGAACGAGCTATTCATCTATTGGAGCAATATCAAAACAATCCCATCTGAACTAAGCACAACTAGAAGTAAAACTAAATCTGATCACAAAAC
TCAACTATGTGGCAGGATCAAAACATAACTATGAACTACTCTTATTATCCATCATTATGGTAATATATTGAAACATTCCCATGAGTCAGAATAATCTCAA
AACCAATTCATCTATTAGATCGATCTAAATCACACAGATCCCTGCCTCGATTCTCACGAAACCCTAAATCGATTGAGAGATTAAGAGGATTACCCTAAAA
TCGCACGAAACCGTAACTCGATTAAGAGGAGGATCACCGTAAAATCGCACGAAACCCTGAGATTGAGACTAACTCGCACGGGATCCTCTTACTTTTTCCA
ACACGAGCATCAAAAACGCAAGATTAGACGGATTCGAGGATTAGAAGAAACTAGACGGTGATTAGTTACCTTGATGAGGCGATTAGAGAACGCAAGCTTT
GCTTCGCTTTCCCTTCGGTCGATTCGATCGCTATGCTATTAATGGAGAGAGAGCCTCTCTATATAAAGCGTGGGCAAGGCGGTGCGAGGCAGCAGCCGGT
GCGGTCACCGCCACGCGTACAGCCCAATGGAAGCGCCACACGTGGCCCGGTTGTGGTGGCGCGACACGTTTCCGGTCCCGGTACGAC