Detailed information on CNT30604015


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONMEST004927, E-value = 3e-20

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678664Oryza punctataSetaria viridis74.7496.5298.89361forward
CNT30524663Oryza punctataSetaria italica42.2435.0599.51204reverse complement
CNT30641718Oryza punctataNymphaea colorata38.9234.7594.15188reverse complement
CNT30549212Oryza punctataIpomoea triloba104.5516.7491.49505reverse complement
CNT30513456Oryza punctataJuglans regia104.5515.9191.88505reverse complement
CNT30272552Oryza punctataChenopodium quinoa89.4434.3491.2432reverse complement
CNT30730494Oryza punctataCorchorus capsularis101.0455.4592.01488reverse complement
CNT30630109Oryza punctataVigna unguiculata101.0415.4891.8488reverse complement
CNT30196906Oryza punctataPisum sativum68.7443.8690.36332reverse complement
CNT30494210Oryza punctataOlea europaea22.154.3884.11107forward
CNT30294119Oryza punctataTriticum aestivum56.3199.6390.81272forward
CNT30220355Oryza punctataHordeum vulgare59.6396.3292.01288reverse complement
CNT30391333Oryza punctataTriticum turgidum10080.599.59483forward
CNT30569398Oryza punctataActinidia chinensis96.2723.890.97465reverse complement
CNT30552690Oryza punctataOryza glaberrima104.3532.9294.64504reverse complement
CNT30442196Oryza punctataAegilops tauschii104.3559.4395.44504forward
CNT30657980Oryza punctataTriticum dicoccoides83.0298.2893.52401forward
CNT30460907Oryza punctataSaccharum spontaneum104.3515.1395.63504reverse complement
CNT3018333Oryza punctataZea mays104.3517.6595.63504reverse complement
CNT30207763Oryza punctataHelianthus annuus104.5554.4891.88505reverse complement
CNT30688674Oryza punctataTriticum urartu104.3538.2795.63504reverse complement
CNT30720843Oryza punctataTriticum spelta18.0140.4797.787reverse complement
CNT30347837Oryza punctataEragrostis tef91.7257.4694.58443forward
CNT30363261Oryza punctataSorghum bicolor42.2416.0399.51204reverse complement
CNT30620564Oryza punctataCajanus cajan100.419.3791.96485forward
CNT30354697Oryza punctataLactuca sativa59.6340.7997.22288reverse complement
CNT30481523Oryza punctataChara braunii13.4627.0895.3865forward
CNT30410880Oryza punctataPapaver somniferum104.5555.7491.88505reverse complement
CNT30642274Oryza punctataCannabis sativa89.655387.76433forward
CNT30319706Oryza punctataAsparagus officinalis98.1416.4992.19474reverse complement
CNT3036965Oryza punctataCucumis melo104.5569.3791.88505reverse complement
CNT30331560Oryza punctataDioscorea rotundata36.4434.8596.02176reverse complement
CNT30148090Oryza punctataBrachypodium distachyon104.3517.3595.63504forward
CNT30104374Oryza punctataOryza rufipogon104.3537.9594.25504forward
CNT30576813Oryza punctataOryza barthii22.9815.06100111reverse complement
CNT30174498Oryza punctataVigna angularis38.9237.2394.15188reverse complement
CNT30551087Oryza punctataOryza brachyantha55.4989.9398.88268forward

Expression of CNT30604015

Peptides detected in this lncRNA

>peptide 1 (70 aa)
HPRMGGEPVAVSAVLPEALGKSEERALILGWAYYLYAFSSYPLRTWLPSVYRRHDNWYTRGASFPVLSML*

>peptide 2 (58 aa)
MDRTVSRRSEPSSRTALMGEQPNPWNHLQLQVAKSRHRGAKPSRRCGLLGKISLLSLE*

>peptide 3 (52 aa)
PSPYGWRTRRCLGCATGGSREVGGESTHLGVGLLLICFQQLSSPHLATQRLP*

>peptide 4 (49 aa)
MLSAVILSALGYPAFTVGTITGTPEVRPSRSSQCSNAHTGYGPNCLTTF*

Sequence

>CNT30604015
CCATCCCCGTATGGGTGGAGAACCCGTCGCTGTCTCGGCTGTGCTACCGGAGGCTCTAGGGAAGTCGGAGGAGAGAGCACTCATCTTGGGGTGGGCTTAC
TACTTATATGCTTTCAGCAGTTATCCTCTCCGCACTTGGCTACCCAGCGTTTACCGTAGGCACGATAACTGGTACACCAGAGGTGCGTCCTTCCCGGTCC
TCTCAATGCTCTAACGCCCACACCGGATATGGACCGAACTGTCTCACGACGTTCTGAACCCAGCTCACGTACCGCATTAATGGGCGAACAGCCCAACCCT
TGGAACCACCTACAGCTCCAGGTGGCGAAGAGCCGACATCGAGGTGCCAAACCTTCCCGTCGATGTGGACTCTTGGGGAAGATCAGCCTGTTATCCCTAG
AGTAACTTTTATCCGTTGAGCGACGGCCCTTCCACTCGGCACCGTCGGATCACTAAGGCCGACTTTCGTCTCTGCTCGACGGG