Detailed information on CNT30603977


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676339Oryza punctataSetaria viridis77.6162.2879.49312forward
CNT30524121Oryza punctataSetaria italica77.8650.4879.23313forward
CNT30132936Oryza punctataLolium perenne25.129.187.13101forward
CNT3017870Oryza punctataZea mays37.5637.2880.13151forward
CNT30339804Oryza punctataEragrostis tef77.8630.1379.55313forward
CNT30366015Oryza punctataSorghum bicolor22.8927.5484.7892forward
CNT30558445Oryza punctataPanicum hallii77.8652.9679.87313forward

Expression of CNT30603977

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MKFSLISDRNLEELLMLPWHAIRHEMIVFI

Sequence

>CNT30603977
TCCCTAACAATTTGCCTTTTTTCCATTGTGATTCGGATTGCAAGCAAGTAGTGGGAGATAAAGGATGAGGCGAGTAAGCAGTGGGAGATGGGGGAAGAGG
TAAAGGATGAGGTGGGCTCTTCAATCCATCCATCATTTTTACCGGTGACCGTGGACTAAATCCAAATTCCCTTGAATTTACATTATTTACAGCAAAAGTA
TGCCCTTTCGGTCCAGGGGAGAGGCTTCTTGTTCTTGGAGCAAGAAAATCCTCGGGCAACATTCTGCCACGTGAACTAGTTTCGCTAGTTGACGGATCAT
CACCGTGCAAATGAAGTTCTCCCTTATTAGTGACAGGAACCTCGAAGAACTTCTGATGCTCCCGTGGCATGCTATAAGACATGAAATGATTGTCTTCATT
TA