Detailed information on CNT30603820


BLAST search results

BLAST vs Swiss-Prot:
sp|O64937|EF1A_ORYSJ, E-value = 0.0

BLAST vs NONCODE:
NONBNAT001751, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30521308Oryza punctataSetaria italica81.1978.4293.49876forward
CNT30535563Oryza punctataEucalyptus grandis73.2296.8185.57790forward
CNT30316757Oryza punctataCorylus avellana68.361.5286.84737forward
CNT3021232Oryza punctataCitrullus lanatus81.1970.7683.79876forward
CNT30727590Oryza punctataCorchorus capsularis80.7264.2887.37871forward
CNT30380230Oryza punctataManihot esculenta81.2836.1585.29877forward
CNT30194937Oryza punctataPisum sativum81.2887.7984.04877forward
CNT30160120Oryza punctataPistacia vera81.9371.1287.67884forward
CNT30287202Oryza punctataTriticum aestivum44.2166.3488.47477forward
CNT30387246Oryza punctataTriticum turgidum81.9376.888.24884forward
CNT3084148Oryza punctataVigna radiata53.6635.5485.49579forward
CNT30541591Oryza punctataBrassica napus81.2874.5785.97877forward
CNT30233904Oryza punctataBrassica oleracea81.2895.6486.32877forward
CNT30246955Oryza punctataAvena sativa81.9350.0890.38884forward
CNT3059230Oryza punctataArabidopsis lyrata81.2872.9687.12877forward
CNT3077042Oryza punctataBrassica juncea81.2872.8486.43877forward
CNT30614135Oryza punctataArabis alpina69.3247.9586.23748forward
CNT30598511Oryza punctataFraxinus excelsior44.4973.7386.04480forward
CNT30449495Oryza punctataSaccharum spontaneum81.5672.3191.48880forward
CNT30132437Oryza punctataLolium perenne81.9373.5487.33884forward
CNT3011166Oryza punctataZea mays81.8462.4590.37883forward
CNT30685098Oryza punctataTriticum urartu48.8435.8591.46527forward
CNT30706337Oryza punctataPrunus avium77.3971.6185.75835forward
CNT30580076Oryza punctataEchinochloa crusgalli37.2630.3991.29402forward
CNT30496962Oryza punctataDigitaria exilis81.8478.5691.51883forward
CNT30594443Oryza punctataEragrostis curvula82.0276.2391.98885forward
CNT30176122Oryza punctataVigna angularis78.9675.2783.57852forward
CNT30724026Oryza punctataLupinus angustifolius78.4158.7585.58846forward

Expression of CNT30603820

Peptides detected in this lncRNA

>peptide 1 (81 aa)
MTPTATVCLMSRTAKRPRGGYSEKVSTTMGLVGIILTIPASPFLRNLGSFSSSLPDRLSILVTSSANLTAMWEVWQSSTGA*

>peptide 2 (96 aa)
MMMTWEVKLAASLAGSSLELEATYPRFRSFTATFFTLNPTLSPGRASWRASWCISTDLTSVVRPLGPKVTTIPGLRTPVSTRPTGTVPIPPILYTS*

Sequence

>CNT30603820
ACAATAATCGGACTCAGAACATCAGTTTTAACCGAACAGAAATAAACGAGAGTATTAAACGACTGACATAGTGCACACTGCGAGCAGATATTAACGGTCC
ATGAAACGAATGCCATGGCCGTGGGCAAAACTTAACCAATACTAGAACAGCTAGATATCTCAAGTGCAGACATGGAAACCACCACTTGAACGAAGCTCAT
TTCTTCTTGGCGGCAGCCTTGGTCACCTTGGCACCGGTTGGGTCCTTCTTCTCGACGTTCTTGATGACGCCAACAGCCACCGTTTGCCTCATGTCACGCA
CGGCAAAACGACCAAGAGGAGGGTACTCAGAGAAGGTCTCCACAACCATGGGCTTGGTGGGAATCATCTTAACCATACCAGCATCACCGTTCTTGAGGAA
CTTGGGCTCCTTCTCCAGCTCCTTACCAGATCGTCTGTCAATCTTGGTCACAAGCTCAGCAAACTTGACAGCAATGTGGGAGGTGTGGCAGTCCAGCACT
GGGGCGTAGCCGTTGCCGATCTGCCCAGGGTGGTTCATGATGATGACCTGGGAGGTGAAGCTGGCAGCCTCCTTGGCAGGGTCATCCTTGGAGTTGGAGG
CCACATACCCACGCTTCAGATCCTTCACGGCAACGTTCTTCACGTTGAACCCGACGTTGTCACCAGGAAGAGCCTCCTGGAGAGCCTCGTGGTGCATCTC
AACCGACTTGACCTCAGTGGTCAGGCCGCTGGGACCAAAGGTCACCACCATACCAGGCTTGAGGACACCAGTCTCAACACGACCCACAGGCACGGTACCA
ATACCACCGATCTTGTACACATCCTGAAGAGGAAGACGCAGAGGCTTGTCTGATGGCCTCTTGGGCTCGTTGATCTGGTCAAGAGCCTCAAGCAAGGTGG
GGCCCTTGTACCAGTCAAGGTTGGTGGACCTCTCGATCATGTTGTCACCCTCAAACCCAGAGATGGGAACGAAGGGAATCTTGTCAGGGTTGTACCCGAC
CTTCTTCAGGTAGGATGAGACTTCCTTCACGATTTCATCATAACGGGCCTTGGAGTACTTGGGAGTGGTGGCATCCATC