Detailed information on CNT30603786


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003442, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30603786

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MHGRSNLQWRIMDHLIGLSSRAIYDYMHSRIDAIMQVCN*

>peptide 2 (37 aa)
GANVNHVDAVMKRVYSSIAQNSRKEYHGLFFQPTACL*

>peptide 3 (37 aa)
MMVLIIQFLLLILEVLCQDKKSLCRPPSHENNYHQEN*

>peptide 4 (76 aa)
MKTIIIKRIEDSILFFLRICRENYSDSGTGSSSHMKLNTTNLYQEQMNNAWQIQSSMENHGPPNWAIFPSYLRLYA*

>peptide 5 (64 aa)
MGSSFSPQPVFSVYPGLVILPQTCIKFRIWKHQTMSNTSIRPAVCPHLQKGLETLRFHTIKRNS*

Sequence

>CNT30603786
TGGAGCTAATGTGAACCATGTAGATGCTGTCATGAAGAGAGTATACAGTAGTATAGCACAAAACAGTAGGAAAGAATACCATGGGCTCTTCTTTCAGCCC
ACAGCCTGTCTTTAGTGTTTACCCAGGGTTGGTTATACTCCCACAGACTTGCATAAAGTTCAGAATTTGGAAGCATCAAACCATGAGTAACACTAGTATA
AGACCAGCCGTTTGTCCTCATTTGCAGAAAGGGTTAGAAACTCTTAGATTTCATACCATCAAGCGTAACAGTTGAACCCCACCATGTCGTTTCTTTGCTA
CTTATAGCATCCCAACTTGATGATCCATTTCATGTTTTCTCTCTTTTTCAGATGCATACTATGATGTCCAATGTGGGTGTCTGAACTGAAATCTGAACTC
TGAAGGTGTTGTTTCCATCAGGTGCATTGGTTCAGCAGCGATCGGTGATCTATGTTTTTCATATGTGAGTGATTTTTGTTTTGTTTTGAAAGGAAGCATA
TTTGGTCTCGTTCTACCAGGCTTTTTCGATGGAAATGAAGGTAATTGGAGGAGTTCTGTCTGTCTGATGGAATTCAGAACCAAAATCCGAATTCCGCAAA
ATGGCTAGAGGCAAATTTTTAGGGCTATTTGCAATTCTAGAACCACAAGCATGGCCAAGTGGTAGTTCTCCAAGTAAAAGAAGTTAGGAGCTGGTTATGA
TGGTACTAATTATTCAGTTTCTTCTATTGATCCTGGAAGTTTTATGCCAGGATAAGAAAAGCTTGTGCAGACCTCCAAGCCATGAAAACAATTATCATCA
AGAGAATTGAAGATTCTATTCTTTTTTTTCTTAGGATCTGCAGGGAAAATTATTCAGATAGTGGAACAGGTTCAAGTAGCCATATGAAACTCAACACAAC
TAATTTATATCAAGAACAAATGAACAATGCATGGCAGATCCAATCTTCAATGGAGAATCATGGACCACCTAATTGGGCTATCTTCCCGAGCTATCTACGA
CTATATGCATAGTAGAATAGATGCAATCATGCAAGTGTGCAACTAGTATGTTTTCTGAAGGAGATGAGATTAGGTAGCATGTAATGGTCCTGGTGTATAG
TGCCATGGCACACTCAACTTGAATATAAACAATGCTAGTCCTGCAGACCTTGC