Detailed information on CNT30603734


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SXF8|PIP13_ORYSJ, E-value = 2e-105

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691492Oryza punctataOryza sativa30.2452.3194.21397forward
CNT30670956Oryza punctataSetaria viridis19.8823.4184.67261forward
CNT30519732Oryza punctataSetaria italica14.4766.284.74190forward
CNT30640394Oryza punctataNymphaea colorata15.1639.882.41199forward
CNT30316259Oryza punctataCorylus avellana6.5526.9683.7286forward
CNT3019525Oryza punctataCitrullus lanatus7.0142.0184.7892forward
CNT30709876Oryza punctataGlycine max6.724.6582.9588forward
CNT30163276Oryza punctataPistacia vera9.2939.6184.43122forward
CNT30297885Oryza punctataTriticum aestivum29.9362.9888.8393forward
CNT30224613Oryza punctataHordeum vulgare11.3554.9890.6149forward
CNT30394052Oryza punctataTriticum turgidum30.0127.5388.83394forward
CNT30564991Oryza punctataActinidia chinensis1548.7683.76197forward
CNT30590280Oryza punctataMusa acuminata9.7524.6685.94128forward
CNT30542732Oryza punctataBrassica napus15.5430.3679.41204forward
CNT30437220Oryza punctataAegilops tauschii1534.4483.25197forward
CNT30658930Oryza punctataTriticum dicoccoides16.3789.9686.98215forward
CNT30463151Oryza punctataSaccharum spontaneum13.434.9983.52176forward
CNT30131632Oryza punctataLolium perenne11.9671.6987.26157forward
CNT308418Oryza punctataZea mays3.7322.0789.849forward
CNT30232947Oryza punctataAnanas comosus15.7787.3485.02207forward
CNT30712987Oryza punctataMalus domestica golden10.8940.0682.52143forward
CNT30680472Oryza punctataTriticum urartu15.0828.4184.34198forward
CNT30366304Oryza punctataSorghum bicolor21.155.8583.39277forward
CNT30595742Oryza punctataOryza meridionalis19.577.5889.06256forward
CNT3024497Oryza punctataPopulus trichocarpa4.6521.7188.5261forward
CNT30325169Oryza punctataAsparagus officinalis14.3971.3282.01189forward
CNT3038976Oryza punctataCucumis melo16.1531.0479.72212forward
CNT30575194Oryza punctataOryza barthii8.6855.6194.74114forward
CNT30495761Oryza punctataDigitaria exilis8.3828.0683.64110forward
CNT30115961Oryza punctataOryza nivara21.7126.0595.09285forward
CNT30112244Oryza punctataFicus carica13.126.0681.98172forward
CNT3050369Oryza punctataCucumis sativus16.2247.2381.22213forward

Expression of CNT30603734

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MPPKDQAMPWIPTVAHLDDDLFTPITVRMLM*

>peptide 2 (36 aa)
TRLIMQRLHRSPHGNNTYCRDLIHHLAASTWLIISE*

Sequence

>CNT30603734
ACGCGCTTAATTATGCAGCGGCTTCATCGATCACCACACGGTAATAACACGTACTGTAGAGACTTGATCCATCATCTTGCAGCATCAACTTGGTTGATTA
TTTCAGAGTAACTATCGCTTAATTAAGCCGATGACGATAATTAGTTAGTCCCGGCTCTTGAAGGGGATGGCCCTGATCACCACCACGTGGTAGATTGCCG
CCAGTGCCGCTCCGATGAACGGGCCCACCCAGAAAATCCACTGTACAAATCCATCCATTAATTGATCGATTAATTAGGCACTAATCAATAAACTAATGGA
TCATCGTGTTGTCTAGTGCTGATTACTAAAAAATCAATTAGCTAATGAATCGTGTTATCTGGTGATGATTGCTAAGGGTCTGTTTGGTTAAAGGGATTAG
TCCCTCCACTTTAATCTATTTTAGTTCCTAAAATCTCATGACTAAAAGGAACTAAGTGTATTAGTCCATTAGTATGGGAGGAGTTTATATGGACTAAAAT
CTTTATTTTCCATCTACTACCCTACATGATCTGGTTCTTATCCTTACGGATTGCATGGTTAGGGGTAACATGGTTTTTATACGGTGTAATTAATGACCTT
TAGTTCCTAGATCCAACTAGGAGGGGACTAAAGTTTTTAACAGGTCCAAGAAAAATCAATGAACTAATGAATCATCGTGTTGTTGATCGGTAAAAAAAAT
CAAAGAACTAATGGTGCGATGATTAGTTAGCAAGTAGAGTGGTGAAATAAAAGCTTACGTGGTCGTGCCATGCGTGGCTACGGTTGTAGACGATGGCGGC
GCCGAGGCCGTCGCCCTTGGTGTAGCCTGGGTTGACGGCGTTGGCGCCGCCGCCGGAGCCCATGTAGAGCGTCTGCTGGAACCCCTTCACCACGCCGGCG
CCGCAGATGGCGCCGAGGCACTGCATCACCATGTAGAACACCGCCCGGGTGAGGGACAGCTTCCTCGCCAGGAAGAGGCCGAAGGTGACGGCCGGGTTGA
TGTGGCCGCCGGAGATGCCGGCGGTGCAGTAGACGAGCGCGAAGATCATGCCGCCGAAGGACCAGGCGATGCCCTGGATCCCCACGGTGGCGCACTTGGA
CGACGACTTGTTCACGCCCATCACCGTCAGGATGCTGATGTAGAGGAACAGGAACGTCGCCACGAACTCCGCGATCCCGGCGCGGTAGAAGGACCACGAC
GTCAGCTCCTCCGCCTCGAACAGCGGCGCCGCCGGCGGCTCACGGTAGTCCTTCTCCTCCGCTCCCTGCGCCGCCGTCCCGATCGGCTGCCTCTCCGTGT
ACCTGTTCGCCCC