Detailed information on CNT30603608


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552520Oryza punctataOryza glaberrima62.2414.9295.73211forward
CNT30108658Oryza punctataOryza longistaminata55.758495.24189forward
CNT30100206Oryza punctataOryza rufipogon65.4915.0695.05222forward
CNT30575182Oryza punctataOryza barthii62.2440.4295.73211forward

Expression of CNT30603608

Peptides detected in this lncRNA

>peptide 1 (55 aa)
NSEVLRDLADRRRCRCGSRRSAAARGRIFAADGLAGAWARLRCCVPILDSKLIQS*

>peptide 2 (81 aa)
MPMRQPAIGRGPRADLRRRWVSRRLGAAPVLCANTRQQTHPKLNQDEMMLLSSLEIEDFDGEGKDESEESSKPNNGSSYIT*

>peptide 3 (34 aa)
RIPRCSATLLTGGDADAAAGDRPRPAGGSSPPMG*

Sequence

>CNT30603608
CGAATTCCGAGGTGCTCCGCGACCTTGCTGACCGGCGGCGATGCCGATGCGGCAGCCGGCGATCGGCCGCGGCCCGCGGGCGGATCTTCGCCGCCGATGG
GTTAGCCGGCGCTTGGGCGCGGCTCCGGTGCTGTGTGCCAATACTCGACAGCAAACTCATCCAAAGCTGAATCAAGATGAGATGATGCTCTTATCTTCTT
TGGAAATTGAAGACTTTGATGGAGAAGGCAAAGACGAAAGCGAAGAGAGCAGCAAACCCAACAACGGCAGTAGCTACATAACCTAAGTAGTCATGCCTGA
ACCCAAAGTATCGTCTGATGTAATCTTGCACCACTTCAC