Detailed information on CNT30603597


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552575Oryza punctataOryza glaberrima39.3652.5690.27514forward
CNT30369514Oryza punctataOryza glumipatula38.9743.1490.57509forward
CNT30100463Oryza punctataOryza rufipogon46.456.0190.92606forward

Expression of CNT30603597

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MLGSWLDPWLLCFVGLQEFLQECPVSDPVIFGVDCSSE*

>peptide 2 (79 aa)
MVRLNLLINNNIFTSVDASATRQCQMNSSTYEVLVRLRRLHIVYWLPLLNISFIAHDMLAWKGSFELIMRPVTILSTEL*

>peptide 3 (88 aa)
AQTLLRLPLLRRERHVSRLCFASTATCRARRATGTAYSLALSLSRARAPSSRRVRRPDPPLPLLNLSLSLSLSLSPVRGATGAAAPIS*

>peptide 4 (92 aa)
SDTSSPSPPPPRATCVAALLRFHGHMPRTARHGHRLLARALSLARARAVLPPRPPPRSASPPFEPLSLSLSLSLSCARRDGRSRTDLVNSPP*

>peptide 5 (46 aa)
MPSPHSTVRACGAPWFLRVMQGDGDKLVVATAHLARKSLGFFRPYR*

>peptide 6 (63 aa)
LRHFFAFPSSAASDMCRGFASLPRPHAAHGAPRAPPTRSRSLSRARARRPPAASAAQIRLSPF*

Sequence

>CNT30603597
GCTCAGACACTTCTTCGCCTTCCCCTCCTCCGCCGCGAGCGACATGTGTCGCGGCTTTGCTTCGCTTCCACGGCCACATGCCGCGCACGGCGCGCCACGG
GCACCGCCTACTCGCTCGCGCTCTCTCTCTCGCGCGCGCGCGCGCCGTCCTCCCGCCGCGTCCGCCGCCCAGATCCGCCTCTCCCCCTTTTGAACCTCTC
TCTCTCTCTCTCTCTCTCTCTCTCTCCTGTGCGAGGCGCGACGGGCGCAGCCGCACCGATCTCGTGAATTCCCCTCCCTGACACTCTCCCAGTCCCCCGC
CCAAATCGCAATGCCTTCTCCGCACTCGACGGTCCGGGCGTGCGGCGCGCCGTGGTTTCTCAGAGTTATGCAAGGGGATGGTGACAAGCTTGTGGTAGCA
ACTGCACATCTTGCCAGAAAATCTTTAGGGTTTTTCAGACCATACCGGTGATTTTCTTGCAAGTTGTGCAGTTGTTGTCTCAAGCTTGCTGCCTCCCTTT
GCCAAAACTATCAAGTGAGAAAGCAGAGTAGAGTTATTCAATTTACGGACACACCAGAAAAAATTAAAGTAATAAACATGTCTGACCAACAAACACGATG
ATTAATAACAGAACTATTGTGGCATGAGATTAATATATTGAAGCATTATGCTTACAACAGTTATAAAATGAAAACTAAATGTAGGCAGGTACATGTTTTG
ACAATGTTGACGTTATCTTAATGGTTCGGCTAAATCTTTTGATTAACAACAATATATTTACTTCCGTGGATGCTAGTGCCACCAGGCAATGTCAAATGAA
CTCATCAACATATGAAGTACTAGTAAGATTACGTCGTCTCCACATTGTGTATTGGCTTCCACTGCTGAATATTTCTTTTATTGCCCATGACATGCTTGCT
TGGAAGGGCAGTTTTGAGTTGATCATGAGGCCAGTCACAATTCTTAGCACTGAACTGTGAATTTCTAAATGCACTATGTTAGGTTCATGGCTTGATCCTT
GGTTACTTTGTTTTGTAGGTTTGCAGGAATTTCTCCAGGAATGCCCAGTGAGTGATCCTGTAATTTTTGGAGTTGATTGTTCATCAGAATAGCACTACAA
TTTTCCTGTCATCTGTGCTTTGGTAGCGGAACGTCCTTTGTCCGATGCTACTCAACAGGAGTGGCAAAGACACATCTTTGTACTTGTGTAAATCAAATAA
GACTGAATAATATATGTTTACTTTTGGAAGGAAAAAGATGTATGACTGTTCTCAAGCAAATGAAACATTCCAGCTTTTGTGAAGTTAAGTTTTGCTGTTA
ACATGC