Detailed information on CNT30603558


BLAST search results

BLAST vs Swiss-Prot:
sp|P22737|IBB3_SETIT, E-value = 4e-15

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690800Oryza punctataOryza sativa13.6720.4784.21114forward
CNT30552066Oryza punctataOryza glaberrima44.7232.3886.6373forward
CNT30595628Oryza punctataOryza meridionalis60.6794.5884.98506forward
CNT3099992Oryza punctataOryza rufipogon13.6727.2785.09114forward
CNT30574713Oryza punctataOryza barthii11.2727.1786.1794forward

Expression of CNT30603558

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MHAWGVIYRATKPIQYSQRASYKLWIRTHGDRIPLPHVLRKMGKKYIC

>peptide 2 (32 aa)
MKRGGSDDSTMSHSLQAAAHCFTSSLQRHRGG*

>peptide 3 (70 aa)
MDFSMLSQHSHGLDFTCFPSVSPALLGRRMLLSVVVAVTMPARRKRKNRMEAAIVLFTFMVILLCLELVS*

Sequence

>CNT30603558
TCGATAGACAAATAGATCTCTCATTCGTCTCTTATTTATCATGATAAGTTCGTAACACATAACATAACATGCATACCAAGATCAAACCACAGTACGATAG
ACAACACACAGACAAACTGTACGCACGTATATATGTCCGAATACGAACAAGCTAGAACAACACACACAGACTGATCGATCGAACGACGCGAACAATCAGC
TGCATGTATATATAGCGCGCGCGTACGCTTAATTTTATTGGTGAAAGGATGAATCAGCTAGCTAGATATAGCTAGCTATAGTTAATTAGTTCATGCGCAC
TTGGGCCCGGGCTCGCCGGTGAAGTGGTCGCGGCAGATGAAGCGAGGCGGCTCCGACGACTCCACCATGTCGCACTCCTTGCAGGCGGCGGCGCACTGCT
TCACCTCGTCGTTGCAACGCCACCGCGGCGGGTAGATCAAGAACATGGACTTCTCGATGTTGTCGCAGCACTCCCACGGTCTGGATTTCACCTGTTTTCC
ATCGGTTTCGCCGGCGTTGCTGGGGAGGCGAATGTTGCTGTCGGTGGTGGTGGCGGTGACGATGCCGGCGAGGAGGAAGAGGAAGAACAGGATGGAAGCG
GCCATTGTGCTCTTTACCTTCATGGTCATCTTACTTTGCTTGGAGCTTGTTAGCTAAGGTTTAGGTGTGGCTTGGTCGTGGTGAAATTAATGCATGCATG
GGGTGTTATTTATCGAGCAACTAAGCCTATCCAGTATTCACAGAGAGCTAGCTATAAACTGTGGATAAGAACACATGGCGACCGGATTCCATTGCCACAC
GTTTTGAGGAAAATGGGGAAAAAATATATATGCC