Detailed information on CNT30603531


BLAST search results

BLAST vs Swiss-Prot:
sp|P12331|CB22_ORYSJ, E-value = 2e-135

BLAST vs NONCODE:
NONBNAT005173, E-value = 1e-45

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690606Oryza punctataOryza sativa39.825096.77434forward
CNT30186317Oryza punctataSecale cereale58.4463.7692.46637forward
CNT30299182Oryza punctataTriticum aestivum57.6159.0893.79628forward
CNT30224983Oryza punctataHordeum vulgare21.9339.1894.98239forward
CNT30552254Oryza punctataOryza glaberrima39.8243.5396.77434forward
CNT30440100Oryza punctataAegilops tauschii57.6161.5793.79628forward
CNT30250793Oryza punctataAvena sativa57.3461.2789.92625forward
CNT30665254Oryza punctataTriticum dicoccoides57.6162.9993.79628forward
CNT30685359Oryza punctataTriticum urartu46.975192.58512forward
CNT30721831Oryza punctataTriticum spelta32.2941.5693.18352forward
CNT30362364Oryza punctataSorghum bicolor51.8355.591.86565forward
CNT30596886Oryza punctataOryza meridionalis54.0457.8695.08589forward
CNT3063160Oryza punctataSelaginella moellendorffii46.0664.2886.25502forward

Expression of CNT30603531

Peptides detected in this lncRNA

>peptide 1 (65 aa)
RSSDIDVSFCVFACDYSSPYVSHGPWVFHTARQTDFPGTNQVKLFYTIRSIVLSSTNQITLFYTI*

>peptide 2 (67 aa)
MRPPSLKIWEPALNHTASPNLTPLRARSSGKTQPSAPSMAHRQWITSSSRFLANVSGSADSPAVSQP*

>peptide 3 (43 aa)
MAWTKNPNMENMARRPFLISFTLSSANASGSSARPSGSKLPPG*

>peptide 4 (48 aa)
MRPSPNTLALATALPARAGEESAMVDAAIDASLGEMATGMLGMCLSSS*

>peptide 5 (41 aa)
VRLILTSRFVFLHVIIRVRTFPMDHGYSIPPGKLISQEQIR*

Sequence

>CNT30603531
TCGTTCGTCTGATATTGACGTCTCGTTTTGTGTTTTTGCATGTGATTATTCGAGTCCGTACGTTTCCCATGGACCATGGGTATTCCATACCGCCAGGCAA
ACTGATTTCCCAGGAACAAATCAGGTAAAATTATTTTACACAATCAGGTCCATTGTCCTTTCATCAACCAACCAGATAACATTATTTTACACAATCTGAA
CGAACGAAGCAAATATTCGGGTACGCGGAAAGTGGAGAACATATATCGCTCGCGCAAAAGCTTGTCTCACCGCAGCCTGCCTGAAGCAATGGAACTCACC
GCCGTTGCTCGCCGGAGATCCACACTCACTTGCCGGGGACGAAGTTGGTGGCGTATGCCCAGGCGTTGTTGTTGACGGGGTCGGCGAGGTGGTCGGCCAA
GTTCTCGAGTGGCCCCTTGCCGGTGACGATGGCCTGGACGAAGAATCCGAACATGGAGAACATGGCGAGGCGGCCGTTCTTGATCTCCTTCACCTTGAGC
TCGGCGAACGCCTCGGGGTCGTCGGCGAGGCCGAGTGGGTCGAAGCTGCCGCCGGGGTAGAGCGGGTCGACGACCTCGCCGAGCGGGCCGCCGGCGATGC
GGCCACCCTCGCTGAAGATCTGGGAGCCCGCCTTGAACCACACGGCCTCGCCGAACTTGACGCCGTTGCGGGCGAGGAGCTCCGGGAAGACGCAGCCGAG
CGCGCCGAGCATGGCCCACCGGCAGTGGATCACCTCCAGCTCCCGGTTCTTGGCGAACGTCTCCGGGTCGGCCGACAGCCCGGCGGTGTCCCAGCCGTAG
TCGCCGGGGAACTCGCCGGTGAGGTAGGACGGCGGCTCGCCGGAGAGCGGGCCGAGGTAGAGCACGCGGTCGGGGCCGTACCACGGGCTTCCGGACGCGG
CGGGCTTGGGCTTGGCCGCCGACTTGCGCATCGTGATGCGGCCCTCGCCGAACACCTTGGCGTTGGCGACCGCCTTGCCGGCGAGGGCAGGGGAGGAGAG
TGCCATGGTGGACGCCGCCATTGACGCGAGCCTTGGAGAAATGGCCACAGGAATGCTTGGAATGTGTCTTTCGAGCTCGTGAGCTGTGGT