Detailed information on CNT30603443


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30603443

Peptides detected in this lncRNA

>peptide 1 (93 aa)
MKREQNSYHGLRETTSAMEIDDSVDSSSTVMADQINWHALEPESKFWICTGVKQISYVSVCFCINTLNCHLVWKDVLGEERYCEKLINNDYIN*

>peptide 2 (47 aa)
MEEAEKERLHWVPLASNLDMDLLPRQYEEGAKQLPWLEGDDVGNGDR*

>peptide 3 (57 aa)
PSHSPSLMLLMPPRLHHAATVVGSPPSLPLHPATTSPFPPLSYWRSGRLVREIEWLD*

>peptide 4 (53 aa)
SLSLSLPDAVDATAPPPCRHRSWVASFSPSPPRHHVPFSPSLVLEEWQAGEGD*

Sequence

>CNT30603443
CTCCCTCTCACTCTCCCTCCCTGATGCTGTTGATGCCACCGCGCCTCCACCATGCCGCCACCGTAGTTGGGTCGCCTCCTTCTCTCCCTCTCCACCCCGC
CACCACGTCCCCTTTTCCCCCTCTCTCGTATTGGAGGAGTGGCAGGCTGGTGAGGGAGATTGAGTGGCTTGACTAGCGGGCGGTGGTGGTGTCACCCGTC
CCCTCTCTTGGCAGGGGCAGATCTGGCTGGTGCGGCCTGCTTGAGCTTTTAATTTGGATCTAGTGTGGAGTGGCTGTAGGAGCTATAGGAGGAGAAGGCA
ACAATTCATATCTAGGGGAGAGAAGGAGAAGGTGATCTTGGGAAGAAGATGGAGGAGGCGGAGAAGGAAAGGCTGCACTGGGTGCCTCTTGCTTCAAATC
TAGACATGGATCTGCTGCCCCGCCAGTATGAAGAGGGAGCAAAACAGCTACCATGGCTTGAGGGAGACGACGTCGGCAATGGAGATCGATGACAGCGTCG
ACAGCTCCTCTACAGTGATGGCAGATCAAATTAACTGGCACGCCCTTGAACCTGAAAGTAAGTTTTGGATCTGCACTGGAGTTAAGCAGATCTCATATGT
CAGCGTGTGTTTTTGCATCAACACATTGAACTGTCACCTTGTTTGGAAGGACGTGCTTGGGGAGGAAAGATACTGTGAAAAATTAATAAATAATGATTAC
ATTAATTAA