Detailed information on CNT30597225


BLAST search results

BLAST vs Swiss-Prot:
sp|P18566|RBS2_ORYSJ, E-value = 4e-89

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30104733Oryza meridionalisOryza rufipogon56.2366.7897.54406forward

Expression of CNT30597225

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MSSSSAVEALYAGSPAAYINSNRIMSFHPWPRLAAERIGEEWLPLRRG*

>peptide 2 (54 aa)
MKLINCTCLTLSKPMMRTKASGYAFFASSSSLSTWVASVHPNMGSFHMVQYLPS*

>peptide 3 (29 aa)
ARMINKYQHFAKPKFHCRRIQICSRHHIT*

Sequence

>CNT30597225
TGCCAGGATGATAAACAAATACCAGCATTTTGCAAAACCAAAATTTCATTGTCGACGGATTCAGATATGCTCTAGGCATCATATTACATGAGTACGCGTG
AACGAAAGCGCTTAGTTGCCGCCTGACTCCTCGCAACCCGGTGGCTTATACGCGATGAAGCTGATTAACTGCACCTGCCTAACGTTGTCAAAGCCAATGA
TGCGAACGAAGGCATCAGGGTATGCCTTCTTTGCCTCCTCGAGCTCCTTGAGCACTTGGGTGGCATCGGTGCATCCAAACATGGGCAGTTTCCACATGGT
CCAGTACCTACCGTCATAGTATCCGGGTGATCTGTGATTCTCACGGTAGACGAATCCGACCTTGCTGAACTCCAAGCAAGGCACCCACTTAGATCGGAGC
AGGTACTCGATCTGCTTCAAGAGATCCTCCACGGTGAGTGGTGGCAGGTACGATAGGGTCTCGAACTTCTTGATGCCCTCAATTGGCCATCACGGTGGGG
GCCATAGCCACGTAGTTAGCTAGCTAGCTTACTGGCTAGTAGTAGTAGAGTATGTCCAGTAGCAGTGCTGTTGAGGCCCTGTACGCTGGTTCACCAGCAG
CTTATATAAACAGCAATCGTATCATGTCATTTCATCCATGGCCACGGTTGGCTGCCGAGAGGATTGGGGAGGAGTGGCTGCCGCTTCGCCGGGGATGATG
CGGCCGGCCAGGCTGGCAGGCC