Detailed information on CNT30597224


BLAST search results

BLAST vs Swiss-Prot:
sp|P18566|RBS2_ORYSJ, E-value = 2e-93

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30578486Oryza meridionalisOryza barthii94.0867.5898.5667forward
CNT30117977Oryza meridionalisOryza nivara94.3670.598.51669forward

Expression of CNT30597224

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MKLINCTCLTLSKPMMRTKASGYAFFASSSSLSTWVASVHPNMGSFHMVQYLPS*

Sequence

>CNT30597224
TGATAAACAAATACCAGCATTTTGCAAAACCAAAATTTCATTGTCGACGGATTCAGATATGCTCTAGGCATCATATTACATGAGTACGCGTGTATAGCCG
GAGATCTTGCATTCACGTGCCCTGTCTCACCGTCACCGAACGATAGACCGATAGTTGTAGTAGTACTCTTGCAACAACGGCAGGTCGGAGCGCGAGAGAA
CAATTACGTGCAGCTTAACACGGACACACAAAAAAAAGAAAAAGAAAGAACATGCACGAAGGAACGAAAGCGCTTAGTTGCCGCCTGACTCCTCGCAACC
CGGTGGCTTATACGCGATGAAGCTGATTAACTGCACCTGCCTAACGTTGTCAAAGCCAATGATGCGAACGAAGGCATCAGGGTATGCCTTCTTTGCCTCC
TCGAGCTCCTTGAGCACTTGGGTGGCATCGGTGCATCCAAACATGGGCAGTTTCCACATGGTCCAGTACCTACCGTCATAGTATCCGGGTGATCTGTGAT
TCTCACGGTAGACGAATCCGACCTTGCTGAACTCCAAGCAAGGCACCCACTTAGATCGGAGCAGGTACTCGATCTGCTTCAAAAGATCCTCCACGGTGAG
TGGTGGCAGGTACGATAGGGTCTCGAACTTCTTGATGCCCTCAATTGGCCACACCTGAATAAATAATGTAAAAATTTAAATCAGGTTAATTTGAATTTCG
TAACATGAG