Detailed information on CNT30597223


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30150857Oryza meridionalisBrachypodium distachyon25.6714.8694.8177forward
CNT30104556Oryza meridionalisOryza rufipogon7178.0299.53213forward

Expression of CNT30597223

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MSSSSAVEALYAGSPAAYINSNRIMSFHPWPRLAAERIGEEWLPLRRG*

>peptide 2 (32 aa)
HWEAGGGLEPLEWSHGGGRGGHHGGGHSHVVS*

>peptide 3 (30 aa)
LTGRPAVDLSPWNGATEVAEEAITVGAIAT*

Sequence

>CNT30597223
CTCACTGGGAGGCCGGCGGTGGACTTGAGCCCCTGGAATGGAGCCACGGAGGTGGCCGAGGAGGCCATCACGGTGGGGGCCATAGCCACGTAGTTAGCTA
GCTAGCTTACTGGCTAGTAGTAGTAGAGTATGTCCAGTAGCAGTGCTGTTGAGGCCCTGTACGCTGGTTCACCAGCAGCTTATATAAACAGCAATCGTAT
CATGTCATTTCATCCATGGCCACGGTTGGCTGCCGAGAGGATTGGGGAGGAGTGGCTGCCGCTTCGCCGGGGATGATGCGGCCGGCCAGGCTGGCAGGCC