Detailed information on CNT30597219


BLAST search results

BLAST vs Swiss-Prot:
sp|P18566|RBS2_ORYSJ, E-value = 2e-91

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30282594Oryza meridionalisChenopodium quinoa16.4932.3483.24173forward
CNT30555575Oryza meridionalisOryza glaberrima44.3327.7199.35465forward
CNT30371494Oryza meridionalisOryza glumipatula26.7941.0295.37281forward
CNT30104481Oryza meridionalisOryza rufipogon43.7656.9599.13459forward
CNT30118016Oryza meridionalisOryza nivara72.2610099.6758forward
CNT30604884Oryza meridionalisOryza punctata47.7673.4693.21501forward

Expression of CNT30597219

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MKLINCTCLTLSKPMMRTKASGYAFFASSSSLSTWVASVHPNMGSFHMVQYLPS*

>peptide 2 (50 aa)
MHLILPPLLTLPKLELLERRFTGRPAVDLSPWKGATEVAEEAITVGAIAT*

>peptide 3 (32 aa)
MSSSSAVEALYAGSPAAYINSNRIMSFHPWPRL

Sequence

>CNT30597219
TGATAAACAAATACCAGCATTTTGCAAAACCAAAATTTCATTGTCGACGGATTCAGATATGCTCTAGGCATCATATTACATGAGTACGCGTGTATAGCCG
GAGATCTTGCATTCACGTGCCCTGTCTCACCGTCACCGAACGATAGACCGATAGTTGTAGTAGTACTCTTGCAACAACGGCAGGTCGGAGCGCGAGAGAA
CAATTACGTGCAGCTTAACACGGACACACAAAAAAAAGAAAAAGAAAGAACATGCACGAAGGAACGAAAGCGCTTAGTTGCCGCCTGACTCCTCGCAACC
CGGTGGCTTATACGCGATGAAGCTGATTAACTGCACCTGCCTAACGTTGTCAAAGCCAATGATGCGAACGAAGGCATCAGGGTATGCCTTCTTTGCCTCC
TCGAGCTCCTTGAGCACTTGGGTGGCATCGGTGCATCCAAACATGGGCAGTTTCCACATGGTCCAGTACCTACCGTCATAGTATCCGGGTGATCTGTGAT
TCTCACGGTAGACGAATCCGACCTTGCTGAACTCCAAGCAAGGCACCCACTTAGATCGGAGCAGGTACTCGATCTGCTTCAAAAGGTCCTCCACTGTCAA
TGGCGGCAAGTACGACAGAGTCTCGAACTTCTTAATGCCCTCAATCGGCCACACCTGATTGAATGAATTGATGCAGACAATAGAATCGGGCCAACATTTA
ATATATATGAACAACGAGCACTTTGAAGGAGAAATTGAAACGTATCGTTTCTGATACCTGCATGCATCTGATCCTTCCGCCATTGCTGACGTTGCCAAAG
CTCGAGCTGCTGGAGCGGCGGTTCACCGGGAGGCCCGCAGTGGACTTGAGCCCCTGGAAGGGAGCCACGGAGGTGGCCGAGGAGGCCATCACGGTGGGGG
CCATAGCCACGTAGTTAGCTAGCTAGCTTACTGGCTAGTAGTAGTAGAGTATGTCCAGTAGCAGTGCTGTTGAGGCCCTGTACGCTGGTTCACCAGCAGC
TTATATAAACAGCAATCGTATCATGTCATTTCATCCATGGCCACGGTTG