Detailed information on CNT30597205


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30604822Oryza meridionalisOryza punctata20.7720.8584.96113forward

Expression of CNT30597205

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MLTSHYFTSCCEHQYYQSTRYVRSEFFLLLSTLLCQND*

>peptide 2 (49 aa)
SRGVRSSSFLPFLPSLSLLPCSAPRSAAVAADLRWMDGWFPPAAAPGAV*

>peptide 3 (50 aa)
MIQEKEIQPCEYVTSIINLAYIYSKYLRACSPVTISLHVVNISIISLPDM*

>peptide 4 (61 aa)
MDGSRQRRRPEPSSLCLSPSLSRGVRPAIASPAAAKYFRRPALLPCWKFQFCFMKIRNFSL*

>peptide 5 (32 aa)
REEFARLPSFPFSLLSRCSPARRLDPRLLPPI*

>peptide 6 (90 aa)
FARSSLVFLPSLSPFSLAAPLLGASIRGCCRRSEMDGWMVPASGGARSRLVSASLPPFRVVFDRRSHRRRRQSISGGLLCSPVGSFSSVL*

Sequence

>CNT30597205
TTCGCGAGGAGTTCGCTCGTCTTCCTTCCTTCCCTTTCTCCCTTCTCTCTCGCTGCTCCCCTGCTCGGCGCCTCGATCCGCGGCTGTTGCCGCCGATCTG
AGATGGATGGATGGATGGTTCCCGCCAGCGGCGGCGCCCGGAGCCGTCTAGTCTCTGCCTCTCTCCCTCCCTTTCGCGTGGTGTTCGACCGGCGATCGCA
TCGCCGGCGGCGGCAAAGTATTTCAGGCGGCCTGCTCTGCTCCCCTGTTGGAAGTTTCAGTTCTGTTTTATGAAGATTAGAAATTTCAGTTTATGATCCA
GGAAAAGGAAATCCAGCCATGTGAGTATGTGACTTCAATTATAAATTTAGCTTATATTTATTCGAAATATCTGAGGGCATGCTCACCAGTCACTATTTCA
CTTCATGTTGTGAACATCAGTATTATCAGTCTACCAGATATGTAAGATCAGAGTTTTTTTTGCTTCTCTCTACTTTGCTATGTCAGAATGATTAGGAAAT
GTCAAAATTGATTTTGAAGAAACAAACGGATGGTTCACTTTTAC