Detailed information on CNT30597198


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673169Oryza meridionalisSetaria viridis7.0924.894.7495forward
CNT30292923Oryza meridionalisTriticum aestivum7.2442.5495.8897forward
CNT30222490Oryza meridionalisHordeum vulgare11.2732.1388.74151forward
CNT30564216Oryza meridionalisActinidia chinensis5.9735.8786.2580forward
CNT3084712Oryza meridionalisVigna radiata4.8522.9786.1565forward
CNT30555733Oryza meridionalisOryza glaberrima86.9481.9397.941165forward
CNT30438727Oryza meridionalisAegilops tauschii4.7820.2596.8864forward
CNT30662078Oryza meridionalisTriticum dicoccoides4.9322.7696.9766forward
CNT304795Oryza meridionalisZea mays7.3121.6893.8898forward
CNT30683149Oryza meridionalisTriticum urartu7.0921.4496.8495forward
CNT30344820Oryza meridionalisEragrostis tef6.1920.3495.1883forward
CNT30582394Oryza meridionalisEchinochloa crusgalli7.5427.0894.06101forward
CNT30115596Oryza meridionalisOryza nivara9.5559.53100128forward

Expression of CNT30597198

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MVIIKNYYLSHQLLVIQISIFSTLNHPPTSNYTIFN*

>peptide 2 (35 aa)
MKGSPLMGCTTWYVGCVQRHKNHTYQILPLSQFTL*

>peptide 3 (35 aa)
PDEEVAVGEADLDAAEQRADGGAVRREVGEVPGCR*

>peptide 4 (36 aa)
MALTVKRGLLVSEAPDSPLGLEHTKLLFISWLAMGA*

>peptide 5 (90 aa)
MPRSSGLTAVRYAGRLERYQAADEGVAIDGLHHLVRWLCTTPQESHISDTPSVPIYSLGFILPLSQNGYHKELLLVPSITCNSNFYLFYP*

>peptide 6 (87 aa)
MGNFSMLFSSLASSTDLLRLDGLDCEAGPPCQRSTRQPPRLGAHQAALHQLARHGSISSGHLSPLVSSFLSLARCSLSPGQKKMDVKQ

>peptide 7 (53 aa)
MFHLSFQSEVDTCKYTPPYIFLLDNIIFQFGFCVKMYPAYRRRYSHAHTNKAI*

>peptide 8 (43 aa)
MLIIQPSLPKRGFVIEITMAKSLRMYYAGKLVTLFIFEIFHIS*

Sequence

>CNT30597198
GGCCCGACGAGGAGGTAGCCGTGGGCGAGGCCGACCTCGATGCCGCGGAGCAGCGGGCTGACGGCGGTGCGGTACGCCGGGAGGTTGGAGAGGTACCAGG
CTGCCGATGAAGGGGTCGCCATTGATGGGCTGCACCACCTGGTACGTTGGCTGTGTACAACGCCACAAGAATCACACATATCAGATACTCCCTCTGTCCC
AATTTACTCTTTAGGATTCATACTCCCTTTGTCTCAAAATGGTTATCATAAAGAATTATTACTTGTCCCATCAATTACTTGTAATTCAAATTTCTATCTT
TTCTACCCTTAACCATCCTCCTACATCCAACTACACAATATTTAATTAGGAGTATTATAGTTTTTTTTCTCAAACCTTAATCTATACTAAATTATTTAAA
ACGACAGGTAATATGAGACGGAGGGAGTAAATGTTTCATTTATCGTTCCAATCAGAAGTAGACACGTGTAAATACACACCACCATATATATTTCTTTTAG
ATAATATTATATTTCAATTCGGCTTCTGCGTCAAGATGTATCCGGCCTACAGACGCCGATATAGTCACGCTCACACAAATAAAGCTATTTAATTAAGCTC
TAGAAAACGTACGCTCTTGTTTCTTGCATATATTATGGACTTATGGTTTACACTTACCATATAGCTAGAACTTATACAAAGTTAACTATAAATTAATGCA
TCCAATTTTGGCTAAATTAGTGTAACTATATCTTCTAAAATCGTCATGCTAATAATCCAACCCTCTCTCCCAAAAAGGGGATTTGTGATCGAAATAACGA
TGGCAAAAAGTTTAAGGATGTACTACGCAGGCAAACTTGTTACTCTCTTCATCTTTGAAATTTTTCACATTTCATAGTATTACGATGTGTCTAATCTACA
GAGGGATTACAACAATTCAATATTATATTGCTAATTGAGGAAATAAACTAGTGAACAGAGCAATAAAAATACAACAAAATGAAAACGATTATGTCTGAAA
TCTACCATCTGATTTTACTTAACAGAGCTTGTTCTTGAGAAACATGCAAGTTTTACACTAGCTTTGATGAAGCGAAATGGGAAATTTCTCAATGCTCTTT
AGCAGTCTAGCTAGCTCTACTGACCTTCTCAGACTGGATGGCCTTGACTGTGAAGCGGGGCCTCCTTGTCAGCGAAGCACCAGACAGCCCCCTCGGCTTG
GAGCACACCAAGCTGCTCTTCATCAGCTGGCTCGCCATGGGAGCATAAGCAGTGGCCATCTCTCTCCTCTCGTCTCTTCCTTTCTCTCCCTAGCTAGATG
CTCTCTCTCTCCCGGCCAAAAAAAAATGGATGTGAAACAG