Detailed information on CNT30597167


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697529Oryza meridionalisOryza sativa20.5530.83100127forward
CNT30166677Oryza meridionalisPistacia vera14.5621.6384.4490forward
CNT30349481Oryza meridionalisEragrostis tef15.723.2191.7597forward
CNT30371436Oryza meridionalisOryza glumipatula66.0255.6695.34408forward
CNT30104555Oryza meridionalisOryza rufipogon65.5355.5699.51405forward

Expression of CNT30597167

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MNGTFCTQQHKRFQIKSCSTPVRSIKNQSSIDVIHPERGLVFDRMKRVEFVKVMK*

>peptide 2 (71 aa)
STQMIQIHSEHDKRSIMHAVVSYHKGSRYRNVFMAGQSIDDHPQIITISRRRWIRTCTSPSPRTRSRDHLR*

>peptide 3 (52 aa)
MQLCHITKVLGTGMFSWLANRSMIILRSSPFPEDVGSALVLLLPLALDLEII*

Sequence

>CNT30597167
TCTCCACTCAGATGATACAAATACACAGTGAGCACGACAAGCGTTCAATTATGCATGCAGTTGTGTCATATCACAAAGGTTCTAGGTACAGGAATGTTTT
CATGGCTGGCCAATCGATCGATGATCATCCTCAGATCATCACCATTTCCAGAAGACGTTGGATCCGCACTTGTACTTCTCCTTCCCCTCGCACTCGATCT
CGAGATCATCTGAGATGAATGGGACTTTCTGCACGCAACAACACAAGAGGTTTCAGATTAAATCATGCAGTACTCCTGTTCGTTCCATAAAAAACCAATC
TAGTATAGATGTGATACATCCTGAACGAGGTTTGGTTTTTGATAGGATGAAGAGAGTGGAATTTGTGAAAGTAATGAAGTGATGAGACCTTCTGCTTGGC
GAGGTCCTGGCAGCCGGTGAAGTTGTAGGGGAACTGGCAGCTGCCGAACTCGACGGTGTACGCCCTCGCGAAGTTGGCGCCGCTCGCCGACGACGCTGGT
GCTCACTCCGGCCATGGCTCGAGCTGCGCGTGTGCAAGAATTTGGTTGGTTGGAGACGACGACCAGGACGGTGTGGTGATGGTTTATTGGTTTTGTGTGT
GATGAGAGTTGGGTTGGG