Detailed information on CNT30597145


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697101Oryza meridionalisOryza sativa75.1535.6285.71623forward
CNT30347040Oryza meridionalisEragrostis tef23.8814.6384.34198forward
CNT30371291Oryza meridionalisOryza glumipatula96.7478.0997.01802forward
CNT30105152Oryza meridionalisOryza longistaminata56.8210092.78471forward
CNT30117830Oryza meridionalisOryza nivara53.5661.1692.79444forward

Expression of CNT30597145

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MGWVVPNLAMSSVVPITTTLIPIPVIFCKYDWNFVQAASS

>peptide 2 (41 aa)
MRDLQTRASNLSSAGISPPSSISIDVSFGSSPSAGPAALRS*

Sequence

>CNT30597145
CATGACATATGCTCCTTTCACCTAAACTGACTGAATAATCAGTAGCAGCTAGAATCTGTGAAAGGCATACCCAGCCTTCTAAACTATATTGTCAAAGCGT
AGACAATGTATTCTTTCTAGAAAATTTTCCCCCAGATTAAGATTTGTGTCTGTGTATTCTCAGAGGTAGACCGTGTTCCTCTTACCAACCATGCGTCGCG
GTTTCCGTTTCTCATACGTAGCTATGTAGTTACAGTAGGGTGGAATGCGAGATCTCCAGACCAGGGCATCAAACTTATCTTCAGCAGGAATATCACCACC
CAGCAGCATCTCTATTGACGTTAGCTTTGGTAGCTCACCTTCTGCAGGGCCAGCCGCCCTAAGATCATAAACCAGGCAACCTTGAACTTGACCATCCACA
ACAGCTAGCCTGCTCATATCAACAGGGATATTTCTTTCGAAAAGATCCTCAGGGTGTAGACCAGAGGAAGTCAATTGCTTCCGTGCCAGCTCTCTTAAGA
ATAATAAGATTCTCTTCCAGAATTGAGTGTTAGGATTAGCTCTTAATAGTTCACCATATATAGTTGCACCAAGAAACGATCCATTCATCTCAGTAGATAG
CTGCATGGCCAGAGATGCTAGTTTTGGATGCTCATCAGGATCCATACTTCCAAAAGCAAGTGCCTTGAAGTAGTACCAAAACTCTTCTTCAGATAGCCTC
TTCACCCTGATGGGTTGGGTTGTCCCAAACTTAGCAATGTCCTCTGTTGTACCTATCACTACAACCTTAATTCCAATACCGGTCATATTCTGCAAATATG
ATTGGAATTTTGTCCAAGCTGCCTCATCC