Detailed information on CNT30597137


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555377Oryza meridionalisOryza glaberrima98.7790.1190.27483forward
CNT30104172Oryza meridionalisOryza rufipogon76.2899.4799.46373forward
CNT30578141Oryza meridionalisOryza barthii96.5295.5590.89472forward

Expression of CNT30597137

Peptides detected in this lncRNA

>peptide 1 (90 aa)
MAATKRMAYSISVVFMLLLIISSTFSSCYAAKDMKDREAIIQRHREECKKTCRERHTYCPPEMPCCCMKNAPASSPSSVKNESGDGLVIN*

Sequence

>CNT30597137
CTGAAGAGGGCAGATACATACAAACAAGAGCTCAGAGCTTGTTTCTTCAGTGATCTCTCCTAATGGCAGCTACCAAGAGGATGGCTTACTCCATCTCGGT
GGTTTTCATGCTTCTTTTGATCATCTCTTCCACCTTCTCATCCTGCTACGCAGCTAAAGATATGAAGGACCGAGAAGCAATAATACAGCGCCATCGCGAA
GAGTGTAAGAAAACATGCAGAGAACGTCATACTTACTGCCCGCCTGAGATGCCATGCTGCTGCATGAAGAACGCCCCGGCATCATCTCCCAGTAGTGTCA
AGAATGAAAGCGGCGATGGGCTTGTAATTAATTAATTAAATTGATTGATCATCTCCCATCCAAATTTCTAACGGATCGATTTGTTAGTTTGATGCTATCT
CAATGAATAAACATTCATGATTTTGTTATATTATGAAAACGTGGTTATTACTCCATGGTTGCAAACAATTAAGGGGCAGCAGAGAAGAG