Detailed information on CNT30597089


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697113Oryza meridionalisOryza sativa41.1419.7596.86318forward
CNT30524216Oryza meridionalisSetaria italica23.0325.1184.27178forward
CNT30581942Oryza meridionalisEchinochloa crusgalli13.221.9491.18102forward

Expression of CNT30597089

Peptides detected in this lncRNA

>peptide 1 (78 aa)
GNHSAMSTMMKTTSRQFTQVANISQPQIQTLGPSYQKIRMNRFFKSISKLDDNLHVHLTHSSTLLKLVPPSRVKLKLT*

>peptide 2 (51 aa)
KPFSNVNDDENHFETIYSGSKYFSATNPNTWSFLSEDQNEQVFQIHLQTRR*

>peptide 3 (40 aa)
MKNPSMENMASRPFLISFTFSSAACTRHRRRGRPRRRRRR*

Sequence

>CNT30597089
GGAAACCATTCAGCAATGTCAACGATGATGAAAACCACTTCGAGACAATTTACTCAGGTAGCAAATATTTCTCAGCCACAAATCCAAACACTTGGTCCTT
CCTATCAGAAGATCAGAATGAACAGGTTTTTCAAATCCATCTCCAAACTCGACGATAATTTACACGTACATTTAACACATTCTTCCACCCTTCTCAAACT
TGTCCCTCCTTCCCGGGTAAAATTAAAATTAACTTGAGGCCAGCTAGCGTCGCCGGCGGCGAGATGTTTACAGGCTGGGCGTCCTCTCGGCGGCGCCGGA
GATGACGGTGAGCAGGTTGTTGCCGAAGGGGTTCTCGACGGGGCCCTCGCCGGTGACGTAGGCCTGGATGAAGAACCCCAGCATGGAGAACATGGCCAGC
CGCCCGTTCTTGATCTCCTTCACCTTCAGCAGCGCCGCCTGTACTCGGCACCGCCGACGAGGACGACCTCGGCGGCGACGGCGACGATGAGGTTGATGGG
GATGCTGTTGCCGAAGTAGTTGAGGGTGTTGCCGTCCAGGAGGAGGGCGCCGGTCTGCATATACCATGAGTGAGTTCACTTCAGAGATTCAGGTATTGAG
CTTGAGTGATCAGTGAATTAGCTGAATTGCCGATGATCAGTGGCTAGTACACGCACCTTGAACCAGACGGCCTCGGGGCCGCAGTTGGCGCCGAACTTGT
TGCAGGCCTCGGGGATGATGAACCCGGCAGCGCCGAGCATCGCCCACCTGGCATGGATCAGCTCATAGGCCTG