Detailed information on CNT30597069


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0DKY4|METK1_ORYSJ, E-value = 7e-118

BLAST vs NONCODE:
NONATHT001922, E-value = 2e-33

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672380Oryza meridionalisSetaria viridis24.7962.4791.53496forward
CNT30520816Oryza meridionalisSetaria italica24.7957.4191.33496forward
CNT30641080Oryza meridionalisNymphaea colorata11.9426.787.03239forward
CNT30549537Oryza meridionalisIpomoea triloba17.0451.283.58341forward
CNT30515028Oryza meridionalisJuglans regia8.820.7386.36176forward
CNT30698521Oryza meridionalisQuercus lobata12.3944.2187.1248forward
CNT30373104Oryza meridionalisArabidopsis thaliana24.5458.5280.24491forward
CNT30266729Oryza meridionalisChenopodium quinoa16.7425.9985.97335forward
CNT3021108Oryza meridionalisCitrullus lanatus22.7427.6482.42455forward
CNT30729630Oryza meridionalisCorchorus capsularis20.4950.0681.71410forward
CNT30381460Oryza meridionalisManihot esculenta23.3450.8283.08467forward
CNT30402638Oryza meridionalisBeta vulgaris20.9932.7986.67420forward
CNT30524807Oryza meridionalisPhaseolus vulgaris12.5428.4687.65251forward
CNT30628391Oryza meridionalisVigna unguiculata22.5439.3283.37451forward
CNT30712616Oryza meridionalisGlycine max11.2927.886.28226forward
CNT30158121Oryza meridionalisPistacia vera9.229.4486.96184forward
CNT30638840Oryza meridionalisCapsicum annuum10.8925.5383.03218forward
CNT30189384Oryza meridionalisSecale cereale13.1933.5987.88264forward
CNT30301451Oryza meridionalisTriticum aestivum17.6498.688.95353forward
CNT30225924Oryza meridionalisHordeum vulgare21.2475.4984.47425forward
CNT30389985Oryza meridionalisTriticum turgidum23.0445.3385.9461forward
CNT30561874Oryza meridionalisActinidia chinensis20.6946.9483.09414forward
CNT30508545Oryza meridionalisSolanum lycopersicum733.8286.43140forward
CNT30172560Oryza meridionalisTrifolium pratense11.8934.9585.29238forward
CNT30146819Oryza meridionalisMedicago truncatula13.1435.0285.93263forward
CNT30437887Oryza meridionalisAegilops tauschii18.6453.2985.52373forward
CNT30667060Oryza meridionalisTriticum dicoccoides17.9456.5486.63359forward
CNT3059692Oryza meridionalisArabidopsis lyrata3.5524.5790.1471forward
CNT30471290Oryza meridionalisSaccharum spontaneum24.7955.2391.73496forward
CNT3014998Oryza meridionalisZea mays13.5448.9286.72271forward
CNT30608385Oryza meridionalisGossypium raimondii19.3470.3683.72387forward
CNT30218287Oryza meridionalisKalanchoe fedtschenkoi15.0958.1983.44302forward
CNT3067553Oryza meridionalisLeersia perrieri10.2947.3692.23206forward
CNT30624603Oryza meridionalisDaucus carota14.0442.5885.41281forward
CNT30686785Oryza meridionalisTriticum urartu24.3948.3286.07488forward
CNT30349162Oryza meridionalisEragrostis tef18.4440.592.14369forward
CNT30477100Oryza meridionalisArabidopsis halleri6.331.988.1126forward
CNT30368062Oryza meridionalisSorghum bicolor24.2944.2291.15486forward
CNT30620815Oryza meridionalisCajanus cajan8.8524.2184.75177forward
CNT30358838Oryza meridionalisLactuca sativa8.3524.4283.83167forward
CNT30432398Oryza meridionalisPapaver somniferum16.5927.3582.53332forward
CNT30571189Oryza meridionalisVitis vinifera9.229.8790.76184forward
CNT3055182Oryza meridionalisAmborella trichopoda21.1440.0280.85423forward
CNT30109152Oryza meridionalisOryza longistaminata39.1881.4186.73784reverse complement
CNT3022562Oryza meridionalisPopulus trichocarpa24.0430.7583.78481forward
CNT30331991Oryza meridionalisDioscorea rotundata10.0442.4986.07201forward
CNT30101810Oryza meridionalisOryza rufipogon46.0836.3795.88922forward
CNT30496713Oryza meridionalisDigitaria exilis17.0422.6492.38341forward
CNT30116854Oryza meridionalisOryza nivara46.0337.4595.87921forward
CNT30594307Oryza meridionalisEragrostis curvula4.223.9395.2484forward
CNT30551132Oryza meridionalisOryza brachyantha17.7992.2394.94356forward
CNT30113343Oryza meridionalisFicus carica7.7543.7984.52155forward
CNT30725315Oryza meridionalisLupinus angustifolius24.5448.8184.32491forward

Expression of CNT30597069

Peptides detected in this lncRNA

>peptide 1 (66 aa)
DQQTCCMHNFKRHKGHFQLQQTHELSTHRSPGNHIRTDNQNIGGFISSSQSSVASFLLSPLHKLKQ*

>peptide 2 (65 aa)
MRSANDEATRWVKMEDCLLIKVLLGNDRLDDMLLQVSSNLIVGDCLIMLGRDEDGIKCGHLLLSA*

>peptide 3 (58 aa)
MRSNFVHKTTAEAYQFILAYLTLKWHQSIFFHFPFFYKNSKSQDQGEDCNLPQNSQTS*

>peptide 4 (56 aa)
MVYATKFVLSKQVKKTVARNKTFLLILYIAYVRQDAVLLAPDKTQFWAKIVIPTKS*

>peptide 5 (85 aa)
MMIMPGLKSKFSFTILRISLSGILPVPYVSTNTDSGSGTPMAYDTWTMQRRARPLATMLLAACLATYAPLRSTLVGSLPEKAPPP*

>peptide 6 (68 aa)
MTKRPDGLRWKIVFSSRYCSGMTGLMTCSFRSAAISSLVTVSSCWVEMRTVSSAAIFSYLHKMVFHIL*

>peptide 7 (32 aa)
MAAGGRLRITMLSSEETKHHNGTEQKLPKGSF*

Sequence

>CNT30597069
GACCAACAAACATGTTGCATGCACAACTTCAAAAGGCACAAAGGTCACTTCCAGCTTCAGCAAACACATGAACTGAGCACTCACAGATCACCAGGGAACC
ATATAAGGACAGATAACCAAAACATAGGAGGTTTCATTTCTTCTTCTCAAAGTAGTGTAGCATCTTTCCTTCTTTCACCATTACATAAGCTTAAGCAATA
ACAGATAACAAATCCTCCTCCTCCTCCTCTAGGTAAAATATTCAAACACAATACCCTTATAAGTACTTATTATTAGGAAAGTAGCGTGCATGGGCATAAA
TGGCAGCGGGGGGCAGGTTAAGAATCACAATGCTGAGCAGCGAGGAAACAAAACACCATAATGGGACAGAGCAAAAGCTTCCGAAAGGGAGCTTTTAGGC
AGAAGGCTTCTCCCACTTGAGGGGCTTCACCACCTCCCAGGTGAAGTCTGGGTCGTCCCTTCCGAAGTGACCGTAAGCCGCCGTCTTGAGGTCAAGGTTG
ATGATGATCATGCCAGGCCTGAAGTCGAAGTTCTCCTTCACAATCTTGAGGATCTCCTTGTCAGGGATCCTGCCAGTGCCGTATGTGTCGACGAATACGG
ACAGTGGCTCAGGGACACCAATGGCGTATGATACTTGGACAATGCAGCGGCGAGCAAGGCCACTAGCAACAATGCTCTTGGCAGCTTGCCTTGCGACGTA
TGCTCCACTGCGGTCGACCTTGGTTGGGTCCTTGCCAGAGAAGGCACCACCACCGTGAGCTCCCCAGCCACCATAAGTGTCAATGATGATCTTCCGGCCA
GTGAGACCAGCATCACCATGAGGTCCGCCAATGACGAAGCGACCAGATGGGTTAAGATGGAAGATTGTCTTCTCATCAAGGTACTGCTCGGGAATGACAG
GCTTGATGACATGCTCCTTCAGGTCAGCAGCAATCTCATCGTTGGTGACTGTCTCATCATGCTGGGTAGAGATGAGGACGGTATCAAGTGCGGCCATCTT
CTCCTATCTGCATAAAATGGTATTTCACATACTTTAGACAAAGAAATATCATGAATAAAATGGACATGGTGAGCCTATGAGAAAAAAAGGGGTATAAGTG
ATAGCTAATGTGAAGGGAAGCTGATAGCGACAATTGATTTCTGGAAATGTTTACATAACACACTGAGAGGACAATACTGATCCCTAGAACAAATGGTTTA
TGCAACAAAATTTGTCCTGAGTAAACAGGTTAAAAAAACAGTAGCAAGGAACAAAACATTCCTTTTAATCCTCTATATAGCTTATGTACGCCAAGATGCT
GTTTTGTTGGCACCTGACAAGACACAATTTTGGGCTAAAATAGTTATCCCTACAAAGAGTTGACTGATTTTCTAAGTTCCTTGGGCAAGTGTTAGGTATT
TGTAATATTCTCTACAAGCGCAACAAGCAGGCATAGAGCACAAGGAATCTACCAATTTTCTGCCGGAATCAGCATAAACACATAATCAATCGTGGTGCCA
CTATGTATTGTAACTATCACATAAATATGCCCCTTTTAGGGGTAAACATATCCTGGAGACCTGGAAAAAAAGAGTGAAATTGCTGGCTAGCTTTTAGGGG
TTCTACTATACTCTTTACATGTAACCTTTCCACAAAGAAAAACATAATAAATCATAAAACATGCGCAGCAACTTCGTGCATAAAACAACAGCAGAAGCAT
ATCAATTCATCTTGGCATATTTAACTTTGAAGTGGCACCAATCAATTTTTTTCCATTTTCCGTTCTTTTATAAGAATTCCAAGTCCCAAGACCAAGGGGA
AGACTGCAATCTACCGCAGAACAGTCAAACGAGCTGACAGCCAAAGACATAATACTAGCACTAAAACCGCTGCTCTAGCATGTTGTTTTAGTGCTAGTAT
TAAACATCTCAAAGATCCTACTTCTTCTCTCTCCATCTCCATCCATAATACTCCCTCCGTTTCAAAATGTTTGACACCGTTGACTTTTTAATACGTGTTT
G