Detailed information on CNT30597052


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005704, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696864Oryza meridionalisOryza sativa58.8987.3995.52603forward
CNT30554857Oryza meridionalisOryza glaberrima93.9547.8685.65962forward
CNT30104021Oryza meridionalisOryza rufipogon61.4317.0195.71629forward

Expression of CNT30597052

Peptides detected in this lncRNA

>peptide 1 (42 aa)
HRPPPSIAVPLACRIRRFGSPRSRGKEFRRLFEEVRQVTHSP*

>peptide 2 (39 aa)
MFYCLQINMHYFANYMGSGYYLFARLCHVYLISVLCYLR*

>peptide 3 (47 aa)
MVIIIQLKCDSMVGCGCMVLQVAPMAIKDRFAGCIGRHTTLATSGNG*

>peptide 4 (34 aa)
IGRLPPLPCPSRVESVVLEVRGHEEKSSEDCLKK*

>peptide 5 (33 aa)
MERGGPCDGLCRFRIHLGTRGDCPLPVRDRGET*

>peptide 6 (29 aa)
MFHGHNYPTKMRFYGGLWVHGFASRAHGN*

Sequence

>CNT30597052
CATCGGCCGCCTCCCTCCATTGCCGTGCCCCTCGCGTGTAGAATCCGTCGTTTTGGAAGTCCGCGGTCACGAGGAAAAGAGTTCAGAAGATTGTTTGAAG
AAGTAAGGCAGGTCACACATTCCCCTTGAGCATATTGAGCCTACTTTATAAATGTTTTACTGTTTGCAAATAAACATGCATTATTTTGCTAATTACATGG
GATCCGGGTATTACCTATTTGCTCGCTTGTGTCATGTTTACTTGATATCCGTTCTTTGTTACCTTAGGTAATAAATCGACTAGCTCGTGTTACTTATGTG
ACCTAACTAGAACTATATGCTTAGCCATGCTTAATTACCAATAGCTCAGTTGATGGGATAATTGCAGTATTAGACCTGTTAGTTTCAGAACGAGCTGCGT
GCTTGAGACATCTGACCATGTTTCATGGTCATAATTATCCAACTAAAATGCGATTCTATGGTGGGCTGTGGGTGCATGGTTTTGCAAGTCGCGCCCATGG
CAATTAAGGACCGGTTCGCGGGATGCATTGGAAGACATACAACGCTTGCCACAAGCGGGAATGGGTAACTGCTTGATCTGTAGTATAGCTTTTCTCTAGC
CGACGCTCCCAGGCAAGGGTGGGCGTGATGGAGCGGGGCGGGCCCTGCGACGGCCTCTGTCGCTTCCGGATTCACCTAGGCACGAGAGGGGACTGCCCAT
TGCCCGTTAGGGACAGGGGTGAAACCTGAGGTGTGGTATGCTTGGCTAGAGGGGGTTATATGAAGGGTCTTGTCACAATCACTCGACATGGTGACGTGTC
ATGCATGGCACGGTGACATGCCGGTGGATTGTGTCTTGTGGGTATAGTTGTGCACCTCTGACCAGAGTAAAACTATTCGAATAGCCATGCCCGTGGTTAT
GGGCGATCGACCAGATTCACCGTGGTTAGTCTCACACTTAATAAATCGACCCAATGCACTGTAGTTCAGGTGGGTTGGTTGGGCCTGTTCAACGTGGTGT
AGCGTTGATCAGTGGAGATTTAAT