Detailed information on CNT30596990


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690859Oryza meridionalisOryza sativa38.2127.7896475forward
CNT30555174Oryza meridionalisOryza glaberrima72.8927.9599.34906forward
CNT30105215Oryza meridionalisOryza longistaminata38.2116.5995.16475forward

Expression of CNT30596990

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MLALTPHSCMFSWRKCKIVDFTTYKKFLVNLRYFIPFHLRPSGL*

>peptide 2 (71 aa)
RKAHILPLLSFSRSPLLSLTLFPSAAAHTAAPPHAGRCSLPPAAAPQPLPACIGPVTPHESTPKLTPASST*

>peptide 3 (59 aa)
QKSPHSSSSLFFSFSPSLPHAFPQRRRSHRRSSSRRPLLPASGSCPSAAAGLYRSCDSS*

>peptide 4 (55 aa)
EKPTFFLFSLFLVLPFSPSRFSPAPPLTPPLLLTPAAAPCLRQLPLSRCRPVSVL*

Sequence

>CNT30596990
CAGAAAAGCCCACATTCTTCCTCTTCTCTCTTTTTCTCGTTCTCCCCTTCTCTCCCTCACGCTTTTCCCCAGCGCCGCCGCTCACACCGCCGCTCCTCCT
CACGCCGGCCGCTGCTCCCTGCCTCCGGCAGCTGCCCCTCAGCCGCTGCCGGCCTGTATCGGTCCTGTGACTCCTCATGAATCTACCCCTAAGCTAACCC
CAGCCTCCTCAACCTAAGATGAAACCGGCGGCCAACTCCGGCGAGATAAGGATTTAGGGAAGTTTCCCAGGCCCCTACCGCTGCTACCACCTCGACTCCT
CTCTTCTATCTCCTCCCTGATCTCTAGTGTGTTATATTGGTTGCTACTCCTCTAGAGTTTGTTTGGCACCTTTTTGAGATGAAATCCCTTGCTTCCTCCT
GAGCTTGAGCTGAAACCCCTTCTCCACTTGTAAATCAGGTACCTGTCCTCTTGTCTCTTGTTTTCCAGGTACTTCTTGACTGCTTCTTGCTATCTTTCTC
GATCTGGTACTGGTGATTCTCTTCCTCTTGAAGCTCATTCTCCTGCTTGATTTTTGCTCCATCTTGCTTATTGACCTGAGTTTCTTGCTTCTTCTAAATC
TCAAGCAACCATTGCTTCACCTCCTACTCCCTTGTCTCTCTCCCTCTCTCTGGTTGCTTGACCACGGATGCTATAGTTGAGCTGTGGTGGGGTTGAGGTG
TAGAACTTTTAGTTGGTTATCTCTCTTTCTCCCAATCTCCACTGATTTCCAGCCGATACTGCTTGCTGTTGCTGGGATCTTACTACTACTATGGCTGCTG
TACTACTGGGAGTTGCTAGCTGCAGCTAGGTGTCTATCGTTGCAACCAAGGCTGGCTCTACCAGACTGTGGATAATTCACATTGACATGCTTTATCTCAG
TGCATTTGGTGCTAGTGATTCACCTGCTTGGGCCACGTATGGCTGATGCTAGCTTTGACACCTCACTCTTGCATGTTCAGTTGGAGAAAATGTAAAATTG
TTGACTTTACAACTTATAAGAAATTTTTAGTAAATCTGAGATATTTTATACCTTTTCACTTAAGACCCTCAGGTTTGTAAAATTAGAAATTACTCTCAGA
TTAGGGACGGAGTTGTAACTGTTCTAGAATTTAAGATCAGTTTTGCAAGACTACCAATTACTGTTTGGTTGCGTGACCGTTAACTTATAAGCATTCAAGA
ATAAAACACTCCTAGAATAAAATTGTATACTCTAATATAGCAC