Detailed information on CNT30596966


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696778Oryza meridionalisOryza sativa87.0881.2391.97411forward
CNT30105522Oryza meridionalisOryza longistaminata92.894.494.75438forward
CNT30577807Oryza meridionalisOryza barthii79.24102.7590.91374reverse complement
CNT30117658Oryza meridionalisOryza nivara83.6993.8291.39395forward

Expression of CNT30596966

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MVVAGWLVHGWITSSFITLHCITASTQLLLLFTSLDYSSNPRVDAWRWLS*

Sequence

>CNT30596966
TTAATCATATAATTAGCGATATAATAATAATGGTGGTGATGATTAGTAGCTAGAACAAAAATTTCATCATCAGGATGGTGGTGGCTGGCTGGCTTGTCCA
TGGATGGATTACATCATCATTCATCACACTGCATTGCATTACGGCCTCAACTCAACTGCTGCTGTTATTTACAAGTCTAGATTACTCTAGTAATCCTCGG
GTTGATGCATGGAGATGGCTAAGCTAAGCTAGCTAATGACGACGACGACGACGACGAACTGAACCGCTAAAAACCATGCCGTGGTTTTGATACAGCGGGT
GGTGGAGCGGCGGCGGCGGTGGCGGAGGAGGAGGAGGAGCTCACATGACGGAGCAGGCGTTGGGGTTCTCGTCGCTGAACATCTGGGGGGCGTGGACGTT
GTACGGGTAGGGCTGGTACGCGGCGGCGGCGGCGCCGGGGTGGACGTGGTACGGGTTGAAGCCGTACTGCGG