Detailed information on CNT30596942


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693943Oryza meridionalisOryza sativa37.4558.2795.39412forward
CNT30553350Oryza meridionalisOryza glaberrima37.4565.0995.15412forward
CNT30371382Oryza meridionalisOryza glumipatula36.6458.0794.04403forward
CNT30100403Oryza meridionalisOryza rufipogon32.3628.4895.79356forward
CNT30117852Oryza meridionalisOryza nivara37.4548.6494.66412forward

Expression of CNT30596942

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MPLHACVARCMLGYARGLAGPDRQSAWETQDRDRVRLGLAATQLHR*

>peptide 2 (60 aa)
MCGSVHARLCTWACRSRPAVGLGDARQRPSPARIGGNAAAQVTEQVSVEEIRAGRAADFV*

>peptide 3 (69 aa)
KKKKQENRSCSPSRRTSCALPPPLLFLSSPASPLVQPSPVATAVVVHSRSLEGGREGREEQEGRKEXEI*

>peptide 4 (79 aa)
KKRNRRIAPVALAAAPPALCRRRCCSCLRRRRRWCSRRRSPQPSSSTAGRWKEGEKAEKNRKEGKXGKFDRRREIWGIW*

>peptide 5 (45 aa)
MHVGLQVPTGSRPGRRKTETESGSDWRQRSCTGDRAGFSRRNQSW*

Sequence

>CNT30596942
AAAAAAAAAGAAACAGGAGAATCGCTCCTGTAGCCCTAGCCGCCGCACCTCCTGCGCTCTGCCGCCGCCGCTGCTGTTCCTGTCTTCGCCGGCGTCGCCG
CTGGTGCAGCCGTCGCCGGTCGCCACAGCCGTCGTCGTCCACAGCCGGTCGTTGGAAGGAGGGAGAGAAGGCAGAGAAGAACAGGAAGGAAGGAAAGAAN
GGGAAATTTGATAGAAGAAGGGAAATTTGGGGAATTTGGTGAATATTTCCAAATTCTTCGTTTTTCGTTTTTCTTATACATTAGTACTGCTAGGTACCTA
ATGACATCGATCGGCATGGGGCGGAAGTAGCACCCTTGGACTACACATTATTATTGCACACAACTGAAATTTAGTTTTAGACTATATTTTGTGCTCAGCA
TAAGTTTTGCATAGAACTTGTAAAGGTCATTTAAGGTTCCGATCCTTATTTTTCACGTGGGATTTGTGGAGCTAGGATGGTTTGGATTGTGTGGATTATA
TCGGTATTACCTTTCTTATAACTGCCTGTCGTGATGTCCGTATTTTTAGGGGAGTCTCTGCCGAAATTTCCAATAATTTTAGGACTTAGTTTTTGAGCGT
ATTTTGGTGTGGCATTCTAGGTACGTGGTTACCTGGGGTGTTACAGTAAGTATGCCGTTGCACGCATGTGTGGCTCGGTGCATGCTCGGCTATGCACGTG
GGCTTGCAGGTCCCGACCGGCAGTCGGCCTGGGAGACGCAAGACAGAGACCGAGTCCGGCTCGGATTGGCGGCAACGCAGCTGCACAGGTGACCGAGCAG
GTTTCAGTAGAAGAAATCAGAGCTGGTAGAGCTGCTGATTTTGTTTGAGAGAGAAAAAGGAAATTGAGGATCGAGTTCTATTGTGAATAGGAGTTCTTAC
ACCTACCTTGAGTAGGAGGTTTATGTAGTATAAATAGATGAGGGGTTGAGGCTTGAAAATATCGACTTTTGAGAGAGAGAAGTTAAGGTTTACTTCGAGG
TTTCAATCCTAATTTGTGAGTTGAGAGAGTTGTGCTTTAGTTGCACTTTGTAAATACATATTGATGCAATAAAGTTGATATACTTTCAAGTGTTTCGTCG