Detailed information on CNT30596905


BLAST search results

BLAST vs Swiss-Prot:
sp|Q76H85|H4_SILLA, E-value = 1e-39

BLAST vs NONCODE:
NONGMAT001327, E-value = 1e-35

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695897Oryza meridionalisOryza sativa82.2484.7593.2500forward
CNT30670612Oryza meridionalisSetaria viridis33.225098.51202forward
CNT30522839Oryza meridionalisSetaria italica35.6937.0997.7217forward
CNT30317753Oryza meridionalisCorylus avellana25.8222.5684.71157forward
CNT30549690Oryza meridionalisIpomoea triloba21.7131.4384.85132forward
CNT30375418Oryza meridionalisArabidopsis thaliana10.5327.1287.564forward
CNT30617135Oryza meridionalisSesamum indicum2515.1585.53152forward
CNT3069058Oryza meridionalisQuercus suber21.5514.9782.44131forward
CNT3042757Oryza meridionalisPrunus dulcis23.0323.182.14140forward
CNT30186872Oryza meridionalisSecale cereale25.9931.6694.3158forward
CNT30286361Oryza meridionalisTriticum aestivum37.3441.596.04227forward
CNT30220695Oryza meridionalisHordeum vulgare25.9936.2498.1158forward
CNT30387206Oryza meridionalisTriticum turgidum36.3539.6195.93221forward
CNT30565712Oryza meridionalisActinidia chinensis31.9164.8887.63194forward
CNT30554906Oryza meridionalisOryza glaberrima74.3478.296.68452forward
CNT30434672Oryza meridionalisAegilops tauschii37.3451.8396.04227forward
CNT30239976Oryza meridionalisAvena sativa37.0144.6496.89225forward
CNT30664872Oryza meridionalisTriticum dicoccoides36.6847.4594.17223forward
CNT3082467Oryza meridionalisBrassica juncea25.9922.0481.01158forward
CNT30261175Oryza meridionalisBrassica rapa24.0130.9380.82146forward
CNT30450127Oryza meridionalisSaccharum spontaneum26.9724.5595.73164forward
CNT30143346Oryza meridionalisLolium perenne36.0237.5692.69219forward
CNT3015042Oryza meridionalisZea mays36.6837.6796.86223forward
CNT30229571Oryza meridionalisAnanas comosus34.8751.4693.87212forward
CNT30685043Oryza meridionalisTriticum urartu36.6850.1195.52223forward
CNT30348363Oryza meridionalisEragrostis tef25.6628.0196.79156forward
CNT30620798Oryza meridionalisCajanus cajan32.437.7482.23197forward
CNT30370989Oryza meridionalisOryza glumipatula27.6326.88100168forward
CNT30645368Oryza meridionalisCannabis sativa23.0342.384.29140forward
CNT30325970Oryza meridionalisAsparagus officinalis22.5319.8685.4137forward
CNT30148852Oryza meridionalisBrachypodium distachyon36.1849.5593.64220forward
CNT30103387Oryza meridionalisOryza rufipogon55.9236.4892.94340forward
CNT30577582Oryza meridionalisOryza barthii82.2478.6295.4500forward
CNT30581397Oryza meridionalisEchinochloa crusgalli36.5137.8298.2222forward
CNT30496126Oryza meridionalisDigitaria exilis25.9923.2495.57158forward
CNT30117527Oryza meridionalisOryza nivara73.3677.4397.09446forward

Expression of CNT30596905

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MKQQLQEKRLGYYDELKNMALIESLSNRVALPSRRIRRGCGPGA*

>peptide 2 (69 aa)
MRFTPPLLASLRIAGFVIPWMLSRSTFLCLFAPPFPSPLPPLPLPDIAAAAARRRSRGRNFDLVRSGWRR

Sequence

>CNT30596905
CACCAACTGGAACAATGCAGGTTGCAAAACGTGCATAATTTCACATAGCACGAAAAGAGATTGCAACTGAATTTAGAGGGTAAATCACTGCAGAATTTCT
ATTCCATTCGAACGAACGAACCAGTAGTTCATACATCCCTAATTAATGAAGGAACAGGAGACGAGATGAAACAACAGCTACAGGAGAAGAGGCTAGGCTA
CTACGACGAACTGAAGAACATGGCACTAATCGAATCCCTATCCAATCGCGTGGCCTTGCCTAGCCGCCGAATCCGTAGAGGGTGCGGCCCTGGCGCTTGA
GCGCGTAGACGACGTCCATGGCGGTGACGGCGTCGCGGATGACGTTCTCGAGGAAGATCTTGAGCACGCCGCGGGTCTCCTCGTAGATCAGCCCGGAGAT
GCGCTTCACGCCGCCCCTCCTCGCCAGCCTCCGGATCGCCGGCTTCGTGATCCCCTGGATGTTGTCGCGCAGCACCTTCCTGTGCCTCTTCGCGCCGCCC
TTCCCGAGCCCCTTGCCGCCCTTGCCTCTCCCCGACATCGCCGCCGCCGCCGCTCGCCGCCGGTCGCGAGGAAGAAACTTTGACTTGGTGAGAAGTGGTT
GGCGGCGG