Detailed information on CNT30596815


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30109840Oryza meridionalisOryza longistaminata44.3427.895.16537forward

Expression of CNT30596815

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MDYLHNVYCLPLELHLLHNAHFSDTLWMS*

>peptide 2 (37 aa)
MEKESQHRAATATSTDTCSAAHAPAPTALDFIFICTQ*

>peptide 3 (56 aa)
WVPRVNKISLLLNFSVSPPPQIPNSREQGETLPSPGGNLEERTAARSRPAMGATSA*

>peptide 4 (76 aa)
MPTLVIHCGCPKCANFRCINFIGVNLMCINFRCINLLKKKKVKRYQKRKLRGRGELGDRSRDRFFAIYRFKVAMFF*

Sequence

>CNT30596815
TGGGTCCCACGTGTAAATAAAATATCTCTTCTTCTCAACTTCTCCGTCTCTCCTCCGCCTCAGATCCCCAATTCGCGCGAGCAAGGTGAAACCCTACCGT
CGCCGGGCGGAAATCTGGAGGAGCGGACGGCTGCCAGGAGCCGGCCGGCCATGGGAGCGACGAGCGCGTGAACGCGGCAGCCGGCGGCGAGCGCGTGGCG
GCCAGACGGCCATCCGGCCGATCGCGGGAGCGGCGAGCGTGCGGCGGCCGGCCGGCTAGAGTCCGGCAAGCTAGCGCGCGGGGGACGGACGGCCACAGCA
AGGCTGCAGCTTGTGACAAGAAGCTAGCAGGCACGTCTCTCAGCTGAGACGAAAGCACAGATGCAGGACGGTTGTTGTTGAACTCATCAGCCACATCCTT
CCAATAATACTCTCCCTTCTTGTCATTTCCATCTATAGAATCAACCGAGTTGCTCAACCAAGAACTAATTAACCGTAAGTTCTCCTCTTCTGTCCAATTG
GGCAGGGAGTCGATGACTCCGACCCATGGGAAGAACTGTTGGCAGTGGCTCTAACTGAGGGGTGTTGCAGTGCAAATATTGCTTGGTGGTTTGCAGTTCC
AAACCCCTGATTTGGAGCATGGAGAAGGAGAGCCAACACAGAGCAGCAACGGCTACTTCAACGGACACCTGCTCGGCTGCTCACGCACCAGCACCAACTG
CTTTAGATTTTATATTCATTTGTACACAGTGAACTCAAAAAGTATTGTATTGTGGCCAGCCCATATAGCTAAAGACTGCTTTAGCAATTAATGCCATATG
GACTACCTCCACAATGTATATTGCCTGCCCTTAGAGCTGCATTTATTGCATAATGCCCACTTTAGTGATACATTGTGGATGTCCTAAGTGTGCAAACTTT
AGGTGTATAAACTTTATAGGTGTAAACTTGATGTGTATAAACTTTAGGTGTATAAACTTACTTAAAAAAAAGAAAGTAAAGCGGTACCAAAAAAGGAAAC
TGCGTGGAAGAGGGGAACTAGGCGATCGATCGCGTGATAGGTTTTTCGCTATTTATCGGTTTAAAGTAGCAATGTTTTTCTAATGCTGCCAAAACACACG
AATCACAAAGAGATGTCTTTTGATGACAAAAAAAAAGGAGGATTTTGATAAAAATGAATTGAAAAGTGAAAACCATGGGTTCACCTTGCAAATACAGTTA
TAATATTGTGA